KEGG   Homo sapiens (human): 79637
Entry
79637             CDS       T01001                                 

Gene name
ARMC7
Definition
(RefSeq) armadillo repeat containing 7
  KO
K24825  armadillo repeat-containing protein 7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    79637 (ARMC7)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Minor spliceosome components
   Minor spliceosome associated proteins
    79637 (ARMC7)
SSDB
Motif
Pfam: Arm Arm_2 HEAT Atx10homo_assoc HEAT_2
Other DBs
NCBI-GeneID: 79637
NCBI-ProteinID: NP_078861
HGNC: 26168
Ensembl: ENSG00000125449
Vega: OTTHUMG00000179345
Pharos: Q9H6L4(Tdark)
UniProt: Q9H6L4
Position
17q25.1
AA seq 198 aa
MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLD
LFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAIT
TLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQ
AHSALGIPLPRSVAPRQR
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcccagaagccgaaggtggacccccacgtcgggcggctgggatacctgcaggcgctg
gtcacggaattccaggagacccaaagccaagacgccaaggagcaagtcctcgccaacctc
gccaacttcgcttatgaccccagcaactacgagtatctgcggcagctgcaggtcctggat
ttatttctcgattcgctgtcggaggagaatgagaccctggtggagtttgctattggaggc
ctgtgcaacctgtgcccagacagggccaacaaggagcacatcctgcacgcaggaggtgtc
ccactcatcatcaactgcctatccagccccaatgaggagacggtgctgtctgccatcacc
acgctcatgcacctgagcccgccgggccgcagctttctcccagagctgaccgccacgccc
gtggtgcagtgcatgcttcgcttctccctctcggccagcgccaggctccggaacctggca
cagatcttcctggaggacttctgctccccccgccaggtggccgaggcccgcagccggcag
gcgcactctgccctgggtatcccactgccgaggagcgtggccccacggcagcgctga

DBGET integrated database retrieval system