KEGG   Homo sapiens (human): 79643Help
Entry
79643             CDS       T01001                                 

Gene name
CHMP6, VPS20
Definition
(RefSeq) charged multivesicular body protein 6
  KO
K12195  charged multivesicular body protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    79643 (CHMP6)
  09143 Cell growth and death
   04217 Necroptosis
    79643 (CHMP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79643 (CHMP6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    79643 (CHMP6)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    79643 (CHMP6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   79643 (CHMP6)
  Exosomal proteins of other body fluids (saliva and urine)
   79643 (CHMP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 Peptidase_S46 Het-C
Motif
Other DBs
NCBI-GeneID: 79643
NCBI-ProteinID: NP_078867
OMIM: 610901
HGNC: 25675
Ensembl: ENSG00000176108
Vega: OTTHUMG00000177645
Pharos: Q96FZ7(Tbio)
UniProt: Q96FZ7
Structure
PDB: 

Position
17q25.3
AA seq 201 aa AA seqDB search
MGNLFGRKKQSRVTEQDKAILQLKQQRDKLRQYQKRIAQQLERERALARQLLRDGRKERA
KLLLKKKRYQEQLLDRTENQISSLEAMVQSIEFTQIEMKVMEGLQFGNECLNKMHQVMSI
EEVERILDETQEAVEYQRQIDELLAGSFTQEDEDAILEELSAITQEQIELPEVPSEPLPE
KIPENVPVKARPRQAELVAAS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacctgttcggccgcaagaagcagagccgcgtcacggagcaggacaaggccatc
ctgcaactgaagcagcagcgggacaagctgaggcagtaccagaagaggatcgcccagcag
ctggagcgcgagcgcgccctggcccggcagctgctgcgggacggcaggaaggaacgggcc
aagctgctgctcaagaagaagcgataccaggagcagctcctggacaggacggagaaccag
atcagcagcctggaggccatggttcagagtattgagttcacccagatcgaaatgaaagtg
atggaggggctgcagtttggaaatgagtgtctgaacaagatgcaccaggtgatgtccatt
gaagaggtggagaggatcctggacgagacgcaggaggccgtggagtaccagcggcaaata
gacgagctcctggcaggaagcttcactcaggaggatgaagacgccatcctggaggagctg
agcgcaatcactcaggaacaaatagagctgccagaggttccctccgagccccttcctgag
aagatcccagaaaacgtccctgtcaaggccaggcccaggcaggcggagctggtggcagct
tcgtaa

DBGET integrated database retrieval system