KEGG   Homo sapiens (human): 79646
Entry
79646             CDS       T01001                                 
Symbol
PANK3
Name
(RefSeq) pantothenate kinase 3
  KO
K09680  type II pantothenate kinase [EC:2.7.1.33]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    79646 (PANK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     79646 (PANK3)
SSDB
Motif
Pfam: Fumble
Other DBs
NCBI-GeneID: 79646
NCBI-ProteinID: NP_078870
OMIM: 606161
HGNC: 19365
Ensembl: ENSG00000120137
Pharos: Q9H999(Tchem)
UniProt: Q9H999
Structure
Position
5:complement(168548495..168579368)
AA seq 370 aa
MKIKDAKKPSFPWFGMDIGGTLVKLSYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGS
TGIRDVHLELKDLTLFGRRGNLHFIRFPTQDLPTFIQMGRDKNFSTLQTVLCATGGGAYK
FEKDFRTIGNLHLHKLDELDCLVKGLLYIDSVSFNGQAECYYFANASEPERCQKMPFNLD
DPYPLLVVNIGSGVSILAVHSKDNYKRVTGTSLGGGTFLGLCSLLTGCESFEEALEMASK
GDSTQADKLVRDIYGGDYERFGLPGWAVASSFGNMIYKEKRESVSKEDLARATLVTITNN
IGSVARMCAVNEKINRVVFVGNFLRVNTLSMKLLAYALDYWSKGQLKALFLEHEGYFGAV
GALLGLPNFS
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaagatcaaagatgccaagaaaccctctttcccatggtttggcatggacattggggga
actctagtaaagctctcgtactttgaacctattgatatcacagcagaggaagagcaagaa
gaagttgagagtttaaaaagtattcggaaatatttgacttctaacgtggcatatggatcc
accggcattcgggatgtacaccttgaactgaaagatttaacactttttggccgaagaggg
aacttgcactttatcaggtttccaacccaggacctgcctacttttatccaaatgggaaga
gataaaaacttctcaacattgcagacggtgctatgtgctacaggaggtggtgcttacaag
tttgaaaaagattttcgcacaattggaaacctccacctgcacaaactggatgaacttgac
tgccttgtaaagggcttgctgtatatagactctgtcagtttcaatggacaagccgagtgc
tattattttgctaatgcctcagaacctgagcgatgccaaaagatgccttttaacctggat
gatccctatccactgcttgtagtgaacattggctcaggagtcagtattttagcagtccat
tccaaagacaactataaacgagtgactgggacaagccttggagggggtacctttctgggt
ttatgcagtttattgactggctgtgaaagttttgaagaggctcttgaaatggcatccaaa
ggtgatagcacacaagctgacaagctggtccgtgatatttatggaggagattatgaaaga
tttggtttgccaggttgggctgtagcatctagttttgggaatatgatttataaggagaag
cgagaatctgttagtaaagaagatctggcaagagctactttagttactatcaccaataac
attggttctgtggcacgaatgtgtgctgttaatgagaaaataaacagagttgtctttgtt
ggaaactttttacgtgtcaataccctctcaatgaaacttttggcatatgcactggattac
tggtcaaaaggtcaactaaaagcattgtttctagaacatgagggttactttggagcagtt
ggtgcacttcttgggctgccaaatttcagctaa

DBGET integrated database retrieval system