KEGG   Homo sapiens (human): 79650Help
Entry
79650             CDS       T01001                                 

Gene name
USB1, C16orf57, HVSL1, Mpn1, PN, hUsb1
Definition
(RefSeq) U6 snRNA biogenesis phosphodiesterase 1
Organism
hsa  Homo sapiens (human)
Disease
H00793  Poikiloderma with neutropenia
SSDB OrthologParalogGFIT
Motif
Pfam: HVSL
Motif
Other DBs
NCBI-GeneID: 79650
NCBI-ProteinID: NP_078874
OMIM: 613276
HGNC: 25792
Ensembl: ENSG00000103005
Vega: OTTHUMG00000133456
Pharos: Q9BQ65(Tbio)
UniProt: Q9BQ65 A0A024R6V6
Structure
PDB: 

Position
16q21
AA seq 265 aa AA seqDB search
MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGP
EDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFH
LSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHA
QFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDA
EVLLRVHTEQVRCKSGNKFFSMPLK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcgcccctggtgggctacagcagcagcggctccgaggatgagtccgaggac
gggatgcggaccaggccgggggatgggagccaccgtcgtggccagagcccccttcccagg
cagagatttccagtacctgacagtgtgctgaacatgttcccgggcaccgaggaggggcct
gaagatgacagcacaaaacacgggggacgggtgcgcaccttcccccacgagcgaggcaac
tgggccacccacgtctatgtaccatatgaagccaaggaggagttcctggatctgcttgat
gtgttgctgccccatgcccagacatatgtcccccggctggtaaggatgaaggtgttccac
ctcagcctgtcccagagtgtggttctgcgccaccactggatcctccccttcgtgcaggct
ctgaaagcccgtatgacctccttccacagattcttctttactgccaaccaggtaaagatt
tacaccaatcaagagaaaaccaggacctttattgggcttgaggtcacttcagggcatgcc
cagttcctggacctggtttcagaggtggacagagtcatggaggaattcaacctcaccact
ttctaccaggatccttctttccacctcagcctggcctggtgtgtgggtgatgcacgtctc
cagctggaggggcagtgcctgcaggaactacaggcaatcgtggatgggtttgaagatgct
gaggtgctgctgcgcgtgcacactgagcaagtccgctgcaagtctgggaacaagttcttc
tcgatgcctttgaagtga

DBGET integrated database retrieval system