KEGG   Homo sapiens (human): 79652
Entry
79652             CDS       T01001                                 
Symbol
TMEM204, C16orf30, CLP24
Name
(RefSeq) transmembrane protein 204
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Claudin_3 DUF7027 PMP22_Claudin L_HMGIC_fpl Clc-like ComGE
Other DBs
NCBI-GeneID: 79652
NCBI-ProteinID: NP_001243470
OMIM: 611002
HGNC: 14158
Ensembl: ENSG00000131634
UniProt: Q9BSN7
Position
16:1528678..1555568
AA seq 226 aa
MTVQRLVAAAVLVALVSLILNNVAAFTSNWVCQTLEDGRRRSVGLWRSCWLVDRTRGGPS
PGARAGQVDAHDCEALGWGSEAAGFQESRGTVKLQFDMMRACNLVATAALTAGQLTFLLG
LVGLPLLSPDAPCWEEAMAAAFQLASFVLVIGLVTFYRIGPYTNLSWSCYLNIGACLLAT
LAAAMLIWNILHKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaccgtgcagagactcgtggccgcggccgtgctggtggccctggtctcactcatcctc
aacaacgtggcggccttcacctccaactgggtgtgccagacgctggaggatgggcgcagg
cgcagcgtggggctgtggaggtcctgctggctggtggacaggacccggggagggccgagc
cctggggccagagccggccaggtggacgcacatgactgtgaggcgctgggctggggctcc
gaggcagccggcttccaggagtcccgaggcaccgtcaaactgcagttcgacatgatgcgc
gcctgcaacctggtggccacggccgcgctcaccgcaggccagctcaccttcctcctgggg
ctggtgggcctgcccctgctgtcacccgacgccccgtgctgggaggaggccatggccgct
gcattccaactggcgagttttgtcctggtcatcgggctcgtgactttctacagaattggc
ccatacaccaacctgtcctggtcctgctacctgaacattggcgcctgccttctggccacg
ctggcggcagccatgctcatctggaacattctccacaagagggaggactgcatggccccc
cgggtgattgtcatcagccgctccctgacagcgcgctttcgccgtgggctggacaatgac
tacgtggagtcaccatgctga

DBGET integrated database retrieval system