KEGG   Homo sapiens (human): 79654Help
Entry
79654             CDS       T01001                                 

Gene name
HECTD3
Definition
(RefSeq) HECT domain E3 ubiquitin protein ligase 3
  KO
K12233  E3 ubiquitin-protein ligase HECTD3 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    79654 (HECTD3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     79654 (HECTD3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   79654 (HECTD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT ANAPC10 F5_F8_type_C
Motif
Other DBs
NCBI-GeneID: 79654
NCBI-ProteinID: NP_078878
HGNC: 26117
Ensembl: ENSG00000126107
Vega: OTTHUMG00000008587
Pharos: Q5T447(Tdark)
UniProt: Q5T447 A1A4G1 B3KU34
Position
1p34.1
AA seq 861 aa AA seqDB search
MAGPGPGAVLESPRQLLGRVRFLAEAARSLRAGRPLPAALAFVPREVLYKLYKDPAGPSR
VLLPVWEAEGLGLRVGAAGPAPGTGSGPLRAARDSIELRRGACVRTTGEELCNGHGLWVK
LTKEQLAEHLGDCGLQEGWLLVCRPAEGGARLVPIDTPNHLQRQQQLFGVDYRPVLRWEQ
VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSV
KQYVESIDVSSYTEEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDT
TDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIEIRIVECRDDG
IDVRLRGVKIKSSRQRELGLNADLFQPTSLVRYPRLEGTDPEVLYRRAVLLQRFIKILDS
VLHHLVPAWDHTLGTFSEIKQVKQFLLLSRQRPGLVAQCLRDSESSKPSFMPRLYINRRL
AMEHRACPSRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQ
GGGFRDSLADMSEELCPSSADTPVPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEW
IGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDKETF
EFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQA
GLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNF
TNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEE
KLRYAAYNCVAIDTDMSPWEE
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcctggcccgggcgcggtgctggagtccccccggcagctgctgggccgcgtg
cgcttcttggcagaggcagcgcggagcctccgcgccgggcggccgctgccagcagcgctg
gctttcgtgccgcgagaggtgctctacaagctttacaaggacccagcgggaccgtcgcgc
gtgcttctgccggtgtgggaggcagagggcctggggctgcgtgtgggcgccgcaggccca
gcccccggtaccggctccgggcccctccgcgccgcccgcgacagcattgagctccggcgc
ggcgcctgcgtgcgcaccacgggcgaggagctgtgcaatggccacgggctctgggtgaag
ctgacaaaggagcagctggcagagcacctgggcgactgcgggctgcaggaaggctggctg
ctggtgtgccgcccggcggagggcggagcccgcctggtacccatcgacactcccaaccac
ctccagcggcagcagcagctctttggcgtggattatcggccggtgctcaggtgggaacag
gtggtggacctgacatactcacatcgcctgggatcgagacctcagccggcagaggcatac
gcagaagctgtacaaaggctactctatgtacccccgacatggacctacgagtgcgacgag
gacctgatccacttcttgtatgaccacctgggcaaggaggatgagaacctgggtagcgtg
aagcagtatgtggagagcatagacgtttcctcctacacggaggagttcaacgtgtcctgc
ctgacagacagcaatgccgatacctactgggagagcgatgggtcccagtgccaacactgg
gtacggcttactatgaagaagggcaccattgtcaagaagctgctactcacagtggatacc
acagatgacaactttatgccaaagcgggtggtggtctatgggggtgaaggggacaacctg
aagaagctgagtgacgtgagcattgacgagaccctcatcggggatgtctgtgtcctggag
gacatgaccgtccacctcccgatcatcgagatccgcatcgtggagtgccgagatgatggg
attgatgttcgtctccgaggggtcaagatcaagtcatctagacagcgggaactagggttg
aatgcagacctgttccagccaactagtctggtgcgatatccacgcctagaaggcaccgac
cctgaagtactgtaccgcagagctgtcctcctgcagagattcatcaagatcctcgatagt
gtcctgcaccacctggtacctgcctgggaccacacactgggcaccttcagtgagattaag
caagtgaagcagttcctactgctgtcccgccagcggccaggcctggtggctcagtgcctg
cgtgactctgagagcagcaagcccagcttcatgccacgcctatacatcaaccgccgtctt
gccatggaacaccgtgcctgcccctctcgagaccctgcctgcaagaatgcagtcttcacc
caggtatatgaaggcctcaagccctctgacaaatatgaaaagcccctggactacaggtgg
cccatgcgctatgaccagtggtgggagtgtaaatttattgcagaaggcatcattgaccaa
gggggtggtttccgggacagcctggcagatatgtcagaagagctgtgccctagctcagcg
gatacccccgtgcccctgcccttctttgtacgcacagccaaccagggcaatggcactggt
gaggctcgggacatgtatgtacccaacccctcctgccgagactttgccaagtatgaatgg
atcggacagctgatgggggctgcccttcggggtaaggagttcctggtcctggccctgcct
ggttttgtgtggaagcagctttctggtgaggaggtgagctggagcaaggacttcccagct
gtggactctgtgctggtgaagctcctggaagtgatggaaggaatggacaaggagacgttt
gagttcaagtttgggaaggaactaacattcaccactgtactgagtgaccaacaggtggtg
gagctgatccctgggggtgcaggcatcgtcgtgggatatggggaccgttctcgtttcatc
caactggtccagaaggcacggctagaggagagcaaggagcaggtggcagctatgcaggca
ggtctgctgaaggtggtaccacaggctgtgctggacttgctgacctggcaagagttggag
aagaaagtgtgtggggatccagaggtcactgtggatgctctgcgcaagctcacccggttt
gaggacttcgagccatctgactcgcgggtgcagtatttctgggaggcactgaacaacttc
accaacgaggaccggagccgcttcctgcgctttgtcacgggccgcagtcgcctgccagca
cggatctacatctacccagacaagctgggctacgagaccacagacgcgctgcccgagtct
tccacttgctccagcaccctcttcctgccacactatgccagtgccaaggtatgcgaggag
aagctccgctatgcggcctacaactgcgtggccatcgacactgacatgagcccttgggag
gagtga

DBGET integrated database retrieval system