KEGG   Homo sapiens (human): 79656
Entry
79656             CDS       T01001                                 

Gene name
BEND5, C1orf165
Definition
(RefSeq) BEN domain containing 5
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BEN T4SS OmpH Sec8_exocyst LMBR1 PIN_12
Other DBs
NCBI-GeneID: 79656
NCBI-ProteinID: NP_078879
HGNC: 25668
Ensembl: ENSG00000162373
Vega: OTTHUMG00000008153
Pharos: Q7L4P6(Tdark)
UniProt: Q7L4P6 A0A0S2Z5N0
Position
1p33
AA seq 421 aa
MYAFVRFLEDNVCYALPVSCVRDFSPRSRLDFDNQKVYAVYRGPEELGAGPESPPRAPRD
WGALLLHKAQILALAEDKSDLENSVMQKKIKIPKLSLNHVEEDGEVKDYGEEDLQLRHIK
RPEGRKPSEVAHKSIEAVVARLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPR
ALYEELLRNYQQQQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQD
VLLLRLGSGPAIDLEKVKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVH
LGSGIWVDEEKWHQLQVTQGDSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAVPKPPL
SPHKLSIVRECLYDRIAQETVDETEIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtacgcctttgtgcggttcctggaggacaacgtctgctacgcgctgcccgtgtcgtgc
gtgcgcgacttcagcccccgctcgcggctggattttgacaaccagaaggtgtacgccgtg
taccggggcccggaggaattgggcgccgggcccgagagccccccgcgcgccccccgcgac
tggggcgcgctgttgctccacaaggcccagatcctggcgctggcagaagacaaatctgac
cttgaaaacagtgtgatgcagaagaaaataaaaatccccaagctttctcttaatcatgta
gaagaagatggagaggttaaagattatggggaagaagatttacagcttagacacatcaag
agacctgaggggcggaagccgagcgaagtggcgcacaagagcatcgaggcagtggtggct
cggctagagaagcagaacggcctgagcctgggccatagcacgtgtccggaagaggtcttc
gtggaggcctcgccaggcacagaggacatggacagtctagaagatgctgtggtgccccgg
gctctgtatgaggagctgctgcgcaactaccagcagcaacaggaagagatgcgccacctc
cagcaggagctggagcggactcggaggcagctggtacaacaggccaagaagctcaaggag
tacggggcacttgtgtctgaaatgaaggagctccgtgaccttaaccggaggctccaggac
gtgctgctcctgcggcttggcagcggtcccgccattgatctggaaaaagtaaagtcagaa
tgtctcgagcccgagccggagttacggagcactttcagtgaggaagcaaatacgtcgtcc
tattaccccgctcctgcgcctgtcatggacaagtatatcctagacaatggcaaggtccat
ctgggaagcgggatttgggttgatgaggagaaatggcaccagctacaagtaacccaagga
gattccaagtacacgaagaacttggcagttatgatttggggaacagatgttctgaaaaac
agaagcgtcacaggcgtcgccacaaaaaaaaagaaagatgcagtccctaaaccacccctc
tcgcctcacaaactaagcatcgtcagagagtgtttgtatgacagaatagcacaagaaact
gtggatgaaactgaaattgcacagagactctccaaagtcaacaagtacatctgtgaaaaa
atcatggatatcaataaatcctgtaaaaatgaagaacgaagggaagcaaaatacaatttg
caataa

DBGET integrated database retrieval system