KEGG   Homo sapiens (human): 79661
Entry
79661             CDS       T01001                                 
Symbol
NEIL1, FPG1, NEI1, hFPG1
Name
(RefSeq) nei like DNA glycosylase 1
  KO
K10567  endonuclease VIII-like 1 [EC:3.2.2.- 4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    79661 (NEIL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    79661 (NEIL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     79661 (NEIL1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     79661 (NEIL1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     79661 (NEIL1)
SSDB
Motif
Pfam: Neil1-DNA_bind Fapy_DNA_glyco H2TH
Other DBs
NCBI-GeneID: 79661
NCBI-ProteinID: NP_078884
OMIM: 608844
HGNC: 18448
Ensembl: ENSG00000140398
Pharos: Q96FI4(Tbio)
UniProt: Q96FI4
Structure
Position
15:75347039..75357115
AA seq 390 aa
MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLIL
SPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGKWQPGRGPCVLQEYQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLKIPPFEKARSVLEALQQHRPSPELTLSQKIRTKLQNPDLLELCHSVPKEVVQLG
GKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIWFQGDPGPLAPKGRKSRKKKS
KATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPEAPTVPKKGRR
KGRQAASGHCRPRKVKADIPSLEPEGTSAS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgcctgagggccccgagctgcacctggccagccagtttgtgaatgaggcctgcagggcg
ctggtgttcggcggctgcgtggagaagtcctctgtcagccgcaaccctgaggtgcccttt
gagagcagtgcctaccgcatctcagcttcagcccgcggcaaggagctgcgcctgatactg
agccctctgcctggggcccagccccaacaggagccactggccctggtcttccgcttcggc
atgtccggctcttttcagctggtgccccgcgaggagctgccacgccatgcccacctgcgc
ttttacacggccccgcctggcccccggctcgccctatgtttcgtggacatccgccggttc
ggccgctgggaccttgggggaaagtggcagccgggccgcgggccctgtgtcttgcaggag
taccagcagttcagggagaatgtgctacgaaacctagcggataaggcctttgaccggccc
atctgcgaggccctcctggaccagaggttcttcaatggcattggcaactatctgcgggca
gagatcctgtaccggctgaagatccccccctttgagaaggcccgctcggtcctggaggcc
ctgcagcagcacaggccgagcccggagctgaccctgagccagaagataaggaccaagctg
cagaatccagacctgctggagctatgtcactcagtgcccaaggaagtggtccagttgggg
ggcaaaggctacgggtcagagagcggggaggaggactttgctgcctttcgagcctggctg
cgctgctatggcatgccaggcatgagctccctgcaggaccggcatggccgtaccatctgg
ttccagggggatcctggaccgttggcacccaaagggcgcaagtcccgcaaaaagaaatcc
aaggccacacagctgagtcctgaggacagagtggaggacgctttgcctccaagcaaggcc
ccttccaggacacgaagggcaaagagagaccttcctaagaggactgcaacccagcggcct
gaggggaccagcctccagcaggacccagaagctcccacagtgcccaagaaggggaggagg
aaggggcgacaggcagcctctggccactgcagaccccggaaggtcaaggctgacatccca
tccttggaaccagaggggacctcagcctcttag

DBGET integrated database retrieval system