KEGG   Homo sapiens (human): 79670Help
Entry
79670             CDS       T01001                                 

Gene name
TUT7, PAPD6, TENT3B, ZCCHC6
Definition
(RefSeq) terminal uridylyl transferase 7
  KO
K13291  terminal uridylyltransferase [EC:2.7.7.52]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    79670 (TUT7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.52  RNA uridylyltransferase
     79670 (TUT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TUTF7_u4 PAP_assoc zf-CCHC zf-CCHC_2 NTP_transf_2 zf-CCHC_4 zf-C2H2_2 zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 79670
NCBI-ProteinID: NP_001171988
OMIM: 613467
HGNC: 25817
Ensembl: ENSG00000083223
Vega: OTTHUMG00000020137
Pharos: Q5VYS8(Tbio)
UniProt: Q5VYS8
Structure
PDB: 

Position
9q21.33
AA seq 1495 aa AA seqDB search
MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGN
YGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGP
RIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRS
RPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYP
TAKYTCRLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAVGIAID
KVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFP
AIMSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQSGLLCKVSAGNENACLTT
KHLTALGKLEPKLVPLVIAFRYWAKLCSIDRPEEGGLPPYVFALMAIFFLQQRKEPLLPV
YLGSWIEGFSLSKLGNFNLQDIEKDVVIWEHTDSAAGDTGITKEEAPRETPIKRGQVSLI
LDVKHQPSVPVGQLWVELLRFYALEFNLADLVISIRVKELVSRELKDWPKKRIAIEDPYS
VKRNVARTLNSQPVFEYILHCLRTTYKYFALPHKITKSSLLKPLNAITCISEHSKEVINH
HPDVQTKDDKLKNSVLAQGPGATSSAANTCKVQPLTLKETAESFGSPPKEEMGNEHISVH
PENSDCIQADVNSDDYKGDKVYHPETGRKNEKEKVGRKGKHLLTVDQKRGEHVVCGSTRN
NESESTLDLEGFQNPTAKECEGLATLDNKADLDGESTEGTEELEDSLNHFTHSVQGQTSE
MIPSDEEEEDDEEEEEEEEPRLTINQREDEDGMANEDELDNTYTGSGDEDALSEEDDELG
EAAKYEDVKECGKHVERALLVELNKISLKEENVCEEKNSPVDQSDFFYEFSKLIFTKGKS
PTVVCSLCKREGHLKKDCPEDFKRIQLEPLPPLTPKFLNILDQVCIQCYKDFSPTIIEDQ
AREHIRQNLESFIRQDFPGTKLSLFGSSKNGFGFKQSDLDVCMTINGLETAEGLDCVRTI
EELARVLRKHSGLRNILPITTAKVPIVKFFHLRSGLEVDISLYNTLALHNTRLLSAYSAI
DPRVKYLCYTMKVFTKMCDIGDASRGSLSSYAYTLMVLYFLQQRNPPVIPVLQEIYKGEK
KPEIFVDGWNIYFFDQIDELPTYWSECGKNTESVGQLWLGLLRFYTEEFDFKEHVISIRR
KSLLTTFKKQWTSKYIVIEDPFDLNHNLGAGLSRKMTNFIMKAFINGRRVFGIPVKGFPK
DYPSKMEYFFDPDVLTEGELAPNDRCCRICGKIGHFMKDCPMRRKVRRRRDQEDALNQRY
PENKEKRSKEDKEIHNKYTEREVSTKEDKPIQCTPQKAKPMRAAADLGREKILRPPVEKW
KRQDDKDLREKRCFICGREGHIKKECPQFKGSSGSLSSKYMTQGKASAKRTQQES
NT seq 4488 nt NT seq  +upstreamnt  +downstreamnt
atgggagatacagcaaaaccttatttcgtgaagcgcactaaagaccgggggactatggat
gatgatgacttcagaaggggtcacccccaacaagattatttaataatagatgaccatgct
aaaggccatggcagtaaaatggaaaagggccttcaaaaaaagaagataacaccagggaac
tatgggaatacccccagaaaaggaccatgtgctgtttccagcaatccatatgcatttaaa
aacccaatctacagtcaacccgcttggatgaatgacagccacaaagatcagagtaagaga
tggctgtctgatgaacatactggtaattcagacaactggagagaattcaaacctggacct
agaattcctgttataaaccgacaaagaaaagactcctttcaagaaaatgaagatggttat
aggtggcaagacacaagaggctgcagaactgtaagacgactgtttcataaagacctaaca
agcctagaaaccacgtcagaaatggaagcaggaagtcctgaaaacaagaagcagaggtcc
agacctaggaagccacggaagactagaaatgaggaaaatgagcaggatggagacttggaa
ggccctgtgatcgatgagtctgtactttcaacgaaggagctgctaggcttacagcaggct
gaggagagactgaagagagactgcattgacaggctaaaaaggcgaccacgaaactaccct
acagcaaagtacacctgcagactctgtgatgttttaattgaatccattgcatttgcccat
aagcatatcaaggaaaagaggcacaagaaaaacattaaggagaagcaagaggaagagttg
ctcactacgttacccccaccaacaccctcccagataaatgcagttggcattgccattgac
aaagtggtacaggaatttggcttacacaatgagaacttggaacagaggctggaaattaaa
cgtatcatggaaaatgtgttccaacacaagttaccagattgttccctaagattatatggg
tcatcctgtagcagattgggtttcaaaaattcggatgtaaacattgacatccagtttcca
gccattatgtctcagccagatgtcctcttacttgttcaagaatgtttaaagaacagtgac
tcctttattgatgttgatgcagacttccatgctagggtgccagtggtggtgtgcagagaa
aagcaaagtggtcttctgtgtaaagtgagcgcaggaaatgaaaatgcttgtctgacaaca
aagcatttaactgcccttggaaaactagaaccaaagctggttcctttggtgattgcattt
aggtactgggcaaagctttgcagtatagatcgccctgaagaaggaggtctgccaccttat
gtgtttgccctgatggccattttctttcttcagcagaggaaagaaccccttttgcctgta
tatctaggatcatggattgaaggattctcattaagcaaactagggaatttcaaccttcaa
gacattgaaaaagatgttgtgatctgggaacatactgacagtgctgcaggggacacaggc
ataacaaaagaagaggcaccaagagaaacgccgattaaaaggggacaggtgtcattaata
ttggatgtgaaacaccagccttcagtaccagttgggcagctctgggtggaattgctgcgg
ttctatgctttagaatttaatttggctgatttagtgataagtattcgtgtcaaagaattg
gtatctcgggaattgaaggattggcccaaaaagcgcattgccattgaagatccctactct
gttaaaagaaatgtggcaagaaccctaaatagtcaacctgtgtttgaatatatacttcat
tgtttaaggacaacatacaagtattttgctcttccacacaaaattacaaaatccagcctt
ctaaagcctctgaatgcaattacatgtatttcagaacattctaaagaagtaataaatcat
catccagatgtacaaacaaaagatgataagctcaaaaactcagttttggcccaaggtcct
ggtgctaccagttcagctgcaaatacctgtaaggtacagccacttactcttaaagagact
gctgaaagttttggaagcccaccaaaagaagaaatgggaaatgaacacatcagtgtccac
cctgaaaactcagactgtatccaagcagatgttaactctgatgattacaagggtgataaa
gtataccatccagaaacaggaaggaaaaacgagaaagagaaagttggaaggaagggcaag
catctgttgactgttgatcagaaacgtggagagcatgttgtctgtggcagcacacgtaat
aatgagtcagagagcactttggatttagaaggcttccaaaatcccacagctaaagagtgt
gagggacttgccactttagataacaaggctgatcttgatggagaaagtacagaaggtact
gaggaactagaagactctctaaaccactttacccactcagtacagggccagacatcagaa
atgattccctctgatgaagaggaggaggacgacgaagaagaggaggaggaagaagaacct
aggctcaccattaaccaaagggaagatgaagatggcatggctaatgaagatgagttagac
aacacctacactgggtcaggggatgaggacgccctatctgaagaggatgatgagttaggc
gaagctgctaagtatgaagacgtgaaagaatgtggaaaacatgtagaaagagctctccta
gtggaacttaataaaataagtctcaaggaagaaaatgtatgtgaagaaaaaaattcacct
gtggatcagtctgattttttttatgaattcagtaaacttatcttcaccaaaggcaagtct
cctacggtagtgtgcagcttatgcaaacgagagggtcatctaaagaaggactgtcctgaa
gacttcaaaagaatccagctagaacctctgccaccattaacacccaagtttttaaatatc
ttagatcaagtctgtatccagtgttataaggatttttctccaacaattatagaagatcag
gctcgtgaacatattcggcaaaacctagaaagtttcataagacaggactttccaggaact
aaattgagcctgtttggctcctccaaaaatggatttgggttcaaacagagtgaccttgac
gtctgtatgacaattaatggacttgaaactgctgagggattggactgtgtcagaactatt
gaagaattagcaagagtcctcagaaaacattcaggtctgagaaacatcttacctattaca
acagcaaaggtgccaattgtgaagttcttccatttgagaagtggtctggaagtagatatc
agtttgtataacacattggcccttcataacacaaggcttttatctgcttattccgccatt
gatcccagagtgaagtatttgtgctataccatgaaagtatttacaaagatgtgtgatatt
ggtgatgcatctagaggcagcttatcatcgtatgcatatactcttatggtgctatatttt
ctccagcagaggaatccaccagtcattcctgtccttcaagagatatacaaaggtgaaaag
aaacctgaaatatttgttgatggctggaatatttatttttttgatcaaatagatgaactg
cctacctattggtcagaatgtggaaaaaatacagaatctgttgggcagttatggttgggc
cttcttcgtttctacacagaggaatttgattttaaagaacatgttattagcatcaggaga
aaaagtctgcttacaacttttaagaaacagtggacctcaaaatacattgttattgaagat
ccctttgatttgaatcataatcttggagctggattatcaaggaaaatgacaaattttata
atgaaggcttttatcaatggtagaagagtatttggtattcctgtcaagggatttccaaag
gactacccctcaaaaatggaatacttttttgatccagatgtgttaactgaaggagagctg
gccccaaatgatagatgttgtcgaatttgtggaaaaatcggacacttcatgaaggactgt
cctatgaggagaaaagtaagacggcggcgagatcaggaagatgccctgaaccaaagatac
cctgagaacaaggaaaaaagaagcaaagaggacaaagaaattcacaacaagtacacagaa
agggaggtgtcaacaaaagaagataagcccatacagtgcacacctcagaaagccaagcca
atgcgggcagctgctgacctggggagggagaagatcctcaggccaccagtagaaaaatgg
aagagacaggatgacaaagacttaagagaaaaacgttgttttatttgtggaagagaaggg
cacattaaaaaggaatgcccacagtttaaaggctcttcaggtagcctttccagtaaatat
atgactcagggaaaagcctcagcgaagaggacccagcaggaatcatga

DBGET integrated database retrieval system