KEGG   Homo sapiens (human): 79671Help
Entry
79671             CDS       T01001                                 

Gene name
NLRX1, CLR11.3, DLNB26, NOD26, NOD5, NOD9
Definition
(RefSeq) NLR family member X1
  KO
K12653  NLR family member X1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    79671 (NLRX1)
   04622 RIG-I-like receptor signaling pathway
    79671 (NLRX1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    79671 (NLRX1)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   79671 (NLRX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT LRR_6 AAA_22 AAA_16 DUF815 TsaE AAA_25
Motif
Other DBs
NCBI-GeneID: 79671
NCBI-ProteinID: NP_001269072
OMIM: 611947
HGNC: 29890
Ensembl: ENSG00000160703
Vega: OTTHUMG00000154476
Pharos: Q86UT6(Tbio)
UniProt: Q86UT6
Structure
PDB: 

Position
11q23.3
AA seq 975 aa AA seqDB search
MRWGHHLPRASWGSGFRRALQRPDDRIPFLIHWSWPLQGERPFGPPRAFIRHHGSSVDSA
PPPGRHGRLFPSASATEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPPAELALEHQPPQAGLPPLALSQLFNPDACGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTPLKEVLPLMAAAGSHLLFV
LHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQASILVTTRPSAIGRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPYCGYAVGGSGVSATPAQRDHLVQMLSRNLEG
HHQIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLS
LMAYAARTMGKLAYEGVSSRKTYFSEEDVCGCLEAGIRTEEEFQLLHIFRRDALRFFLAP
CVEPGRAGTFVFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIM
AKLLPLRALPLLFNLIKVVPRVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGAS
ILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKK
KLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVL
GSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQ
ITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQEL
NVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSL
TEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVE
GEVRALLEQLGSSGS
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggggccaccatttgcccagggcctcttggggctctggttttagaagagcactc
cagcgaccagatgatcgtatccccttcctgatccactggagttggccccttcaaggggag
cgtccctttgggccccctagggcctttatacgccaccacggaagctcggtagatagcgct
cccccacccgggaggcatggacggctgttccccagcgcctctgcaactgaagctatacag
cggcaccgccggaacctggctgagtggttcagccggctgcccagggaggagcgccagttt
ggcccaacctttgccctagacacggtccacgttgaccctgtgatccgcgagagtacccct
gatgagctacttcgcccacccgcggagctggccctggagcatcagccaccccaggccggg
ctccccccactggccttgtctcagctctttaacccggatgcctgtgggcgccgggtgcag
acagtggtgctgtatgggacagtgggcacaggcaagagcacgctggtgcgcaagatggtt
ctggactggtgttatgggcggctgccggccttcgagctgctcatccccttctcctgtgag
gacctgtcatccctgggccctgccccagcctccctgtgccaacttgtggcccagcgctac
acgcccctgaaggaggttctgcccctgatggctgctgctgggtcccacctcctctttgtg
ctccatggcttagagcatctcaacctcgacttccggctggcaggcacgggactttgtagt
gacccggaggaaccgcaggaaccagctgctatcatcgtcaacctgctgcgcaaatacatg
ctgcctcaggccagcattctggtgaccactcggccctctgccattggccgtatccccagc
aagtacgtgggccgctatggtgagatctgcggtttctctgataccaacctgcagaagctc
tacttccagctccgcctcaaccagccgtactgcgggtatgccgttggcggttcaggtgtc
tctgccacaccagctcagcgtgaccacctggtgcagatgctctcccggaacctggagggg
caccaccagatagccgctgcctgcttcctgccgtcctattgctggctcgtttgtgccacc
ttgcacttcctgcatgcccccacgcctgctgggcagacccttacaagcatctataccagc
ttcctgcgcctcaacttcagcggggaaaccctggacagcactgacccctccaatttgtcc
ctgatggcctatgcagcccgaaccatgggcaagttggcctatgagggggtgtcctcccgc
aagacctacttctctgaagaggatgtctgtggctgcctggaggctggcatcaggacggag
gaggagtttcagctgctgcacatcttccgtcgggatgccctgaggtttttcctggcccca
tgtgtggagccagggcgtgcaggcaccttcgtgttcaccgtgcccgccatgcaggaatac
ctggctgccctctacattgtgctgggtttgcgcaagacgaccctgcaaaaggtgggcaag
gaagtggctgagctcgtgggccgtgttggggaggacgtcagcctggtactgggcatcatg
gccaagctgctgcctctgcgggctctgcctctgctcttcaacctgatcaaggtggttcca
cgagtgtttgggcgcatggtgggtaaaagccgggaggcggtggctcaggccatggtgctg
gagatgtttcgagaggaggactactacaacgatgatgttctggaccagatgggcgccagt
atcctgggcgtggagggcccccggcgccacccagatgagccccctgaggatgaagtcttc
gagctcttccccatgttcatgggggggcttctctctgcccacaaccgagctgtgctagct
cagcttggctgccccatcaagaacctggatgccctggagaatgcccaggccatcaagaag
aagctgggcaagctgggccggcaggtgctgcccccatcagagctccttgaccacctcttc
ttccactatgagttccagaaccagcgcttctccgctgaggtgctcagctccctgcgtcag
ctcaacctggcaggtgtgcgcatgacaccagtcaagtgcacagtggtggcagctgtgctg
ggcagcggaaggcatgccctggatgaggtgaacttggcctcctgccagctagatcctgct
gggctgcgcacactcctgcctgtcttcctgcgtgcccggaagctgggcttgcaactcaac
agcctgggccctgaggcctgcaaggacctccgagacctgttgctgcatgaccagtgccaa
attaccacactgcggctgtccaacaacccgctgacggcggcaggtgttgccgtgctaatg
gaggggctggcaggaaacacctcagtgacgcacctgtccctgctgcacacgggccttggg
gacgaaggcctggagctgctggctgcccagctggaccgcaaccggcagctgcaggagctg
aacgtggcgtacaacggtgctggtgacacagcggccctggccctggccagagctgcccgg
gagcacccttccctggaactgctacacctctacttcaatgagctgagctcagagggccgc
caggtcttgcgagacttggggggtgctgctgaaggtggtgcccgggtggtggtgtcactg
acagaggggacggcggtgtcagaatactggtcagtgatcctcagtgaagtccagcggaac
ctcaatagctgggatcgggcccgggttcagcgacaccttgagctcctactgcgggatctg
gaagatagccggggtgccacccttaatccttggcgcaaggcccagctgctgcgagtggag
ggcgaggtcagggccctcctggagcagctgggaagctctggaagctga

DBGET integrated database retrieval system