KEGG   Homo sapiens (human): 79672
Entry
79672             CDS       T01001                                 
Symbol
FN3KRP, FN3KL
Name
(RefSeq) fructosamine 3 kinase related protein
  KO
K15523  protein-ribulosamine 3-kinase [EC:2.7.1.172]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    79672 (FN3KRP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.172  protein-ribulosamine 3-kinase
     79672 (FN3KRP)
SSDB
Motif
Pfam: Fructosamin_kin APH RIO1
Other DBs
NCBI-GeneID: 79672
NCBI-ProteinID: NP_078895
OMIM: 611683
HGNC: 25700
Ensembl: ENSG00000141560
Pharos: Q9HA64(Tbio)
UniProt: Q9HA64 A0A140VK84
Position
17:82716706..82728013
AA seq 309 aa
MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLT
AILKTNTVKVPKPIKVLDAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEM
RLKEAGTVGRGGGQEERPFVARFGFDVVTCCGYLPQVNDWQEDWVVFYARQRIQPQMDMV
EKESGDREALQLWSALQLKIPDLFRDLEIIPALLHGDLWGGNVAEDSSGPVIFDPASFYG
HSEYELAIAGMFGGFSSSFYSAYHGKIPKAPGFEKRLQLYQLFHYLNHWNHFGSGYRGSS
LNIMRNLVK
NT seq 930 nt   +upstreamnt  +downstreamnt
atggaggagctcctgaggcgcgagctgggctgcagctctgtcagggccacgggccactcg
gggggcgggtgcatcagccagggccggagctacgacacggatcaaggacgagtgttcgtg
aaagtgaaccccaaggcggaggccagaagaatgtttgaaggtgagatggcaagtttaact
gccatcctgaaaacaaacacggtgaaagtgcccaagcccatcaaggttctggatgcccca
ggcggcgggagcgtgctggtgatggagcacatggacatgaggcatctgagcagtcatgct
gcaaagcttggagcccagctggccgatttacaccttgataacaagaagcttggagagatg
cgcctgaaggaggcgggcacagtggggagaggaggtgggcaggaggaacggccctttgtg
gcccggtttggatttgacgtggtgacgtgctgtggatacctcccccaggtgaatgactgg
caggaggactgggtcgtgttctatgcccggcagcgcattcagccccagatggacatggtg
gagaaggagtctggggacagggaggccctccagctttggtctgctctgcagttaaagatc
cctgacctgttccgtgacctggagatcatcccagccttactccacggggacctctggggt
ggaaacgtagcagaggattcctctgggccggtgatttttgacccagcttctttctacggc
cactcggaatatgagctggcaatagctggcatgtttgggggctttagcagctccttttac
tccgcctaccacggcaaaatccccaaggccccaggattcgagaagcgccttcagttgtat
cagctctttcactacttgaaccactggaatcattttggatcggggtacagaggatcctcc
ctgaacatcatgaggaatctggtcaagtga

DBGET integrated database retrieval system