KEGG   Homo sapiens (human): 79694
Entry
79694             CDS       T01001                                 

Gene name
MANEA, ENDO, hEndo
Definition
(RefSeq) mannosidase endo-alpha
  KO
K15538  glycoprotein endo-alpha-1,2-mannosidase [EC:3.2.1.130]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    79694 (MANEA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.130  glycoprotein endo-alpha-1,2-mannosidase
     79694 (MANEA)
SSDB
Motif
Pfam: Glyco_hydro_99 Lipoprotein_Ltp DUF4434
Other DBs
NCBI-GeneID: 79694
NCBI-ProteinID: NP_078917
OMIM: 612327
HGNC: 21072
Ensembl: ENSG00000172469
Vega: OTTHUMG00000016296
Pharos: Q5SRI9(Tbio)
UniProt: Q5SRI9
Position
6q16.1
AA seq 462 aa
MAKFRRRTCIILALFILFIFSLMMGLKMLRPNTATFGAPFGLDLLPELHQRTIHLGKNFD
FQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYSWYGNPQFDGKY
IHWNHPVLEHWDPRIAKNYPQGRHNPPDDIGSSFYPELGSYSSRDPSVIETHMRQMRSAS
IGVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYNLKVTFHIEPYSNRDDQNMYKNVKY
IIDKYGNHPAFYRYKTKTGNALPMFYVYDSYITKPEKWANLLTTSGSRSIRNSPYDGLFI
ALLVEEKHKYDILQSGFDGIYTYFATNGFTYGSSHQNWASLKLFCDKYNLIFIPSVGPGY
IDTSIRPWNTQNTRNRINGKYYEIGLSAALQTRPSLISITSFNEWHEGTQIEKAVPKRTS
NTVYLDYRPHKPGLYLELTRKWSEKYSKERATYALDRQLPVS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggcaaagtttcggagaaggacttgcatcattttggcactttttattctatttattttc
tctctgatgatgggtttaaaaatgctgagaccaaatacagctacttttggagctcctttt
ggacttgaccttcttccagaacttcatcaacgaactattcatttggggaaaaattttgat
ttccaaaagagtgacagaatcaacagtgaaacaaataccaagaatttaaaaagtgttgaa
atcactatgaaaccttccaaagcctctgaacttaacttggatgaactaccacctctgaac
aattatctacatgtattttattacagttggtatggaaatccacaatttgatggtaaatat
atacattggaatcatccagtgttagagcattgggaccctagaatagccaagaattatcca
caagggagacacaaccctccagatgacattggctccagcttttatcctgaattgggaagt
tacagttctcgggatccttctgtcatagaaactcacatgagacaaatgcgctcagcttca
attggtgtactagccctctcttggtacccacctgatgtaaatgatgaaaatggagaacct
actgataacttggtacccactattttggataaagctcataaatataacctaaaggttact
tttcacatagaaccatatagcaatcgagatgatcaaaacatgtacaaaaatgtcaagtat
attatagacaaatatggaaatcatccggccttttacaggtacaagacgaagactggcaat
gctcttcctatgttttatgtctatgattcctatattaccaagcctgaaaaatgggccaat
ctgttaaccacctcagggtctcggagtattcgcaattctccttatgatggactgtttatt
gcccttctggtagaagaaaaacataagtatgatattcttcaaagtggttttgatggaatt
tacacatattttgccacaaatggctttacttatggctcatcacatcagaattgggctagc
ctaaaattattttgtgataaatacaacttaatatttatcccaagtgtgggcccaggatac
atagataccagcatccgtccatggaacacgcaaaacactcggaaccgaatcaatgggaag
tattatgaaattggtctgagtgccgcacttcagacacgccccagcttaatttctatcacc
tcttttaatgagtggcatgaaggaactcagattgaaaaagctgttcccaaaagaaccagt
aatacagtgtacctagattaccgtcctcataaaccaggtctttacctagaactgactcgc
aagtggtctgaaaaatacagtaaggaaagagcaacttatgcattagatcgccagctgcct
gtttcttaa

DBGET integrated database retrieval system