KEGG   Homo sapiens (human): 79697
Entry
79697             CDS       T01001                                 

Gene name
RIOX1, C14orf169, JMJD9, MAPJD, NO66, ROX, URLC2, hsNO66
Definition
(RefSeq) ribosomal oxygenase 1
  KO
K16914  bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 [EC:1.14.11.- 1.14.11.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    79697 (RIOX1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    79697 (RIOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone H3]-dimethyl-L-lysine36 demethylase
     79697 (RIOX1)
    1.14.11.-  
     79697 (RIOX1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    79697 (RIOX1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    79697 (RIOX1)
SSDB
Motif
Pfam: Cupin_4 Cupin_8 Cupin_1 Cupin_2
Other DBs
NCBI-GeneID: 79697
NCBI-ProteinID: NP_078920
OMIM: 611919
HGNC: 20968
Ensembl: ENSG00000170468
Vega: OTTHUMG00000166530
Pharos: Q9H6W3(Tbio)
UniProt: Q9H6W3
Structure
PDB: 

Position
14q24.3
AA seq 641 aa
MDGLQASAGPLRRGRPKRRRKPQPHSGSVLALPLRSRKIRKQLRSVVSRMAALRTQTLPS
ENSEESRVESTADDLGDALPGGAAVAAVPDAARREPYGHLGPAELLEASPAARSLQTPSA
RLVPASAPPARLVEVPAAPVRVVETSALLCTAQHLAAVQSSGAPATASGPQVDNTGGEPA
WDSPLRRVLAELNRIPSSRRRAARLFEWLIAPMPPDHFYRRLWEREAVLVRRQDHTYYQG
LFSTADLDSMLRNEEVQFGQHLDAARYINGRRETLNPPGRALPAAAWSLYQAGCSLRLLC
PQAFSTTVWQFLAVLQEQFGSMAGSNVYLTPPNSQGFAPHYDDIEAFVLQLEGRKLWRVY
RPRVPTEELALTSSPNFSQDDLGEPVLQTVLEPGDLLYFPRGFIHQAECQDGVHSLHLTL
STYQRNTWGDFLEAILPLAVQAAMEENVEFRRGLPRDFMDYMGAQHSDSKDPRRTAFMEK
VRVLVARLGHFAPVDAVADQRAKDFIHDSLPPVLTDRERALSVYGLPIRWEAGEPVNVGA
QLTTETEVHMLQDGIARLVGEGGHLFLYYTVENSRVYHLEEPKCLEIYPQQADAMELLLG
SYPEFVRVGDLPCDSVEDQLSLATTLYDKGLLLTKMPLALN
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggatgggctccaggccagtgcagggccgttgaggcgcgggcggccgaagcgccggcgc
aagccccagccacacagcgggtcggtcctggccctgcccttgaggtccaggaagatacga
aagcagctgcgaagtgttgtatcccgcatggcagcgctgaggacgcagacgctgcctagc
gagaactcggaggaatcgagggtggagtcgacggccgacgacctgggggacgcgctaccc
ggtggggcggcggtggcggccgtcccggacgcagcccggcgagagccatacggccacctg
gggcccgcagagctgctggaggcctcgcccgccgcgcgctccctgcagaccccgtcggcg
cgcctggtgcccgcttccgcgccgcccgcgcgcctggtggaggtgcccgccgcgccggtc
cgggtggtggagacctcggccctgctgtgcaccgcgcaacacttagcggccgtccagtcg
tccggggcccctgcgacggcgtcggggccgcaggtggataacacgggtggggagccggcc
tgggactccccgctgcggcgcgtcttggccgagctgaaccgcatccccagcagccggcgg
cgagcggcccgcctctttgagtggctcatcgcgcccatgccgccagatcacttttaccgg
cgcctatgggagcgcgaggcggtgctggtgcggcggcaggaccacacctactaccaggga
cttttctctaccgctgacctggattcgatgctgcgcaacgaggaggtgcagttcggccag
catttggacgccgctcgctacatcaacggacgacgcgagaccctgaacccacccggccgc
gcgctgcccgccgccgcgtggtccctgtaccaggccggctgctccctgcgtctcctctgt
ccgcaggctttctctactactgtgtggcagtttttggctgtgcttcaagagcagtttgga
agcatggcaggctccaacgtttacctcacgccccctaactcgcagggctttgccccccac
tacgacgacatcgaggccttcgtgctgcagctggaaggtaggaaactctggcgtgtatac
cgaccccgagtcccaaccgaggaactggctctgacatccagccccaacttcagtcaggac
gacctcggtgagccggtgctgcagaccgtgctggaacctggagatttgctgtattttcct
cggggcttcattcaccaagctgaatgccaggatggagtccactctctgcacctcaccttg
tccacgtaccagcgcaatacctggggtgacttcttagaggccatactgcctctggcagtg
caggctgcaatggaagaaaatgtggagtttcggaggggtctgccccgagacttcatggat
tacatgggggcccagcattcagattctaaggatccgcgaagaaccgctttcatggagaag
gtgcgggtcttggttgcccgcctgggacactttgctcctgttgatgctgtggccgaccag
cgagccaaagacttcattcacgattctctgccccctgttttgactgatagggagagggca
ctaagtgtttacgggcttccaattcgctgggaggctggagaacctgtaaacgtgggggcc
cagttgacaacagaaacagaagtccatatgcttcaggatgggatagctcggctggtgggt
gaggggggccatttgtttctctattacacagtggaaaactcccgtgtgtatcatctggaa
gaacccaagtgcttggaaatatacccccagcaagctgatgccatggaactgttgcttggt
tcttatccagagtttgtgagagtgggggacctgccctgtgacagtgtggaggaccagctg
tccttggcaaccacgttgtatgataaggggctgctgctcactaagatgcctctagcccta
aattag

DBGET integrated database retrieval system