KEGG   Homo sapiens (human): 79713Help
Entry
79713             CDS       T01001                                 

Gene name
IGFLR1, TMEM149, U2AF1L4
Definition
(RefSeq) IGF like family receptor 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Death
Motif
Other DBs
NCBI-GeneID: 79713
NCBI-ProteinID: NP_078936
OMIM: 614143
HGNC: 23620
Ensembl: ENSG00000126246
Vega: OTTHUMG00000182064
Pharos: Q9H665(Tdark)
UniProt: Q9H665
Position
19q13.12
AA seq 355 aa AA seqDB search
MGPGRCLLTALLLLALAPPPEASQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENC
GLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAK
GHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLPLVVLVLLLTLAVIAILL
FILLWHLCWPKEKADPYPYPGLVCGVPNTHTPSSSHLSSPGALETGDTWKEASLLPLLSR
ELSSLASQPLSRLLDELEVLEELIVLLDPEPGPGGGMAHGTTRHLAARYGLPAAWSTFAY
SLRPSRSPLRALIEMVVAREPSASLGQLGTHLAQLGRADALRVLSKLGSSGVCWA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggggcctggacgatgcctcctgacggccttgttgcttctggccctggcgccaccgccg
gaagcctcccagtactgcggccgccttgaatactggaacccagacaacaagtgctgcagc
agctgcctgcaacgcttcgggccgcccccctgcccggactatgagttccgggaaaactgc
ggactcaatgaccacggcgatttcgtaacgcccccgttccgaaagtgttcttctgggcag
tgcaaccccgacggcgcggagctatgtagcccctgcggcggcggagccgtgacccctact
cccgccgcgggcgggggcagaaccccgtggcgctgcagagagaggccggtccctgccaag
gggcactgccccctcacacctggaaacccaggcgcccctagctcccaggagcgcagctca
ccagcaagttccattgcctggaggacccctgagcctgtccctcagcaggcctggccgaat
ttccttccgctcgtggtgctggtcctgctcctgaccttggcggtgatagcgatcctcctg
tttattctgctctggcatctctgctggcccaaggagaaagccgacccctatccctatcct
ggcttggtctgcggagtccccaacacccacaccccttcctcctcgcatctgtcctcccca
ggcgccctggagacaggggacacatggaaggaggcctcactacttccactcctgagcagg
gaactgtccagtctggcgtcacaacccctgtctcgcctcctggatgagctggaggtgctg
gaagagctgattgtactgctggaccctgagcctgggccaggtgggggtatggcccatggc
actactcgacacctggccgcaagatatgggctgcctgctgcctggtccacctttgcctat
tcgctgaggccgagtcgctcgccgctgcgggctctgattgagatggtggtggcaagggag
ccctctgcctccctgggccagcttggcacacacctcgcccagctagggcgggcagatgca
ttgcgggtgctgtccaagcttggctcatctggggtttgctgggcttaa

DBGET integrated database retrieval system