KEGG   Homo sapiens (human): 79716Help
Entry
79716             CDS       T01001                                 

Gene name
NPEPL1, bA261P9.2
Definition
(RefSeq) aminopeptidase like 1
  KO
K09611  probable aminopeptidase NPEPL1 [EC:3.4.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    79716 (NPEPL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     79716 (NPEPL1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   79716 (NPEPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M17 Pdase_M17_N2
Motif
Other DBs
NCBI-GeneID: 79716
NCBI-ProteinID: NP_078939
HGNC: 16244
Ensembl: ENSG00000215440
Vega: OTTHUMG00000033060
Pharos: Q8NDH3(Tdark)
UniProt: Q8NDH3
Position
20q13.32
AA seq 523 aa AA seqDB search
MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEELWQAALSTLN
PNPTDSCPLYLNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRCIVMVCEQPEV
FASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRL
AARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPPA
LAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQ
GFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDL
GADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFS
EFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGV
ALLLALFGRASEDPLLNLVSPLGCEVDVEEGDLGRDSKRRRLV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgtggggctgcagttccaggcgagcgcgggggactcggacccacagagccgg
cccctgctgctgctcgggcagctgcaccacctgcaccgcgtgccctggagccacgtccgc
gggaagctgcagccccgggtcaccgaggagctctggcaggctgccctgagcacgctcaac
cccaaccccacggacagctgtcccctctacctgaactacgccaccgtggctgccctgccc
tgcagggtgagccggcacaacagcccctcggccgcccacttcatcacgcggctggtgcgg
acctgcctgccgcccggagcgcatcgctgcattgtgatggtctgcgagcagccggaggtc
tttgcttccgcctgtgccctggcccgggccttcccgctgttcacccaccgctcaggtgcc
tctcggcgcttggagaagaagacggtcaccgtggagtttttcctggtgggacaagacaac
gggccggtggaggtgtccacattgcagtgcttagcgaatgccacagacggcgtgcggcta
gcagcccgcatcgtggacacaccctgcaatgagatgaacaccgacaccttcctcgaggag
attaacaaagttggaaaggagctggggatcatcccaaccatcatccgggatgaggaactg
aagacgagaggatttggaggaatctatggggttggcaaagccgccctgcatcccccagcc
ctggccgtcctcagccacaccccagatggagccacgcagaccatcgcctgggtgggcaaa
ggcatcgtctatgacactggaggcctcagcatcaaagggaagactaccatgccggggatg
aagcgagactgcgggggtgctgcggccgtcctgggggccttcagagccgcaatcaagcag
ggtttcaaagacaacctccacgctgtgttctgcttggctgagaactcggtggggcccaat
gcgacaaggccagatgacatccacctgctgtactcagggaagacggtggaaatcaacaac
acggatgccgagggcaggctggtgctggcagatggcgtgtcctatgcttgcaaggacctg
ggggccgacatcatcctggacatggccaccctgaccggggctcagggcattgccacaggg
aagtaccacgccgcggtgctcaccaacagcgctgagtgggaggccgcctgtgtgaaggcg
ggcaggaagtgtggggacctggtgcacccgctggtctactgccccgagctgcacttcagc
gagttcacctcagctgtggcggacatgaagaactcagtggcggaccgagacaacagcccc
agctcctgtgctggcctcttcatcgcctcacacatcggcttcgactggcccggagtctgg
gtccacctggacattgctgcaccggtgcatgctggtgagcgagccacaggcttcggtgtg
gccctcctgctggcgctcttcggccgtgcctctgaggaccctctgctgaacctggtgtcc
ccactgggctgtgaggtggatgtcgaggagggggacctggggagggactccaagagacgc
aggcttgtgtga

DBGET integrated database retrieval system