KEGG   Homo sapiens (human): 79716
Entry
79716             CDS       T01001                                 
Symbol
NPEPL1, bA261P9.2
Name
(RefSeq) aminopeptidase like 1
  KO
K09611  probable aminopeptidase NPEPL1 [EC:3.4.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    79716 (NPEPL1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   79716 (NPEPL1)
SSDB
Motif
Pfam: Peptidase_M17 Pdase_M17_N2
Other DBs
NCBI-GeneID: 79716
NCBI-ProteinID: NP_078939
HGNC: 16244
Ensembl: ENSG00000215440
UniProt: Q8NDH3
Position
20:58689131..58715844
AA seq 523 aa
MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEELWQAALSTLN
PNPTDSCPLYLNYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRCIVMVCEQPEV
FASACALARAFPLFTHRSGASRRLEKKTVTVEFFLVGQDNGPVEVSTLQCLANATDGVRL
AARIVDTPCNEMNTDTFLEEINKVGKELGIIPTIIRDEELKTRGFGGIYGVGKAALHPPA
LAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGAAAVLGAFRAAIKQ
GFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADGVSYACKDL
GADIILDMATLTGAQGIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFS
EFTSAVADMKNSVADRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGV
ALLLALFGRASEDPLLNLVSPLGCEVDVEEGDLGRDSKRRRLV
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggcgaacgtggggctgcagttccaggcgagcgcgggggactcggacccacagagccgg
cccctgctgctgctcgggcagctgcaccacctgcaccgcgtgccctggagccacgtccgc
gggaagctgcagccccgggtcaccgaggagctctggcaggctgccctgagcacgctcaac
cccaaccccacggacagctgtcccctctacctgaactacgccaccgtggctgccctgccc
tgcagggtgagccggcacaacagcccctcggccgcccacttcatcacgcggctggtgcgg
acctgcctgccgcccggagcgcatcgctgcattgtgatggtctgcgagcagccggaggtc
tttgcttccgcctgtgccctggcccgggccttcccgctgttcacccaccgctcaggtgcc
tctcggcgcttggagaagaagacggtcaccgtggagtttttcctggtgggacaagacaac
gggccggtggaggtgtccacattgcagtgcttagcgaatgccacagacggcgtgcggcta
gcagcccgcatcgtggacacaccctgcaatgagatgaacaccgacaccttcctcgaggag
attaacaaagttggaaaggagctggggatcatcccaaccatcatccgggatgaggaactg
aagacgagaggatttggaggaatctatggggttggcaaagccgccctgcatcccccagcc
ctggccgtcctcagccacaccccagatggagccacgcagaccatcgcctgggtgggcaaa
ggcatcgtctatgacactggaggcctcagcatcaaagggaagactaccatgccggggatg
aagcgagactgcgggggtgctgcggccgtcctgggggccttcagagccgcaatcaagcag
ggtttcaaagacaacctccacgctgtgttctgcttggctgagaactcggtggggcccaat
gcgacaaggccagatgacatccacctgctgtactcagggaagacggtggaaatcaacaac
acggatgccgagggcaggctggtgctggcagatggcgtgtcctatgcttgcaaggacctg
ggggccgacatcatcctggacatggccaccctgaccggggctcagggcattgccacaggg
aagtaccacgccgcggtgctcaccaacagcgctgagtgggaggccgcctgtgtgaaggcg
ggcaggaagtgtggggacctggtgcacccgctggtctactgccccgagctgcacttcagc
gagttcacctcagctgtggcggacatgaagaactcagtggcggaccgagacaacagcccc
agctcctgtgctggcctcttcatcgcctcacacatcggcttcgactggcccggagtctgg
gtccacctggacattgctgcaccggtgcatgctggtgagcgagccacaggcttcggtgtg
gccctcctgctggcgctcttcggccgtgcctctgaggaccctctgctgaacctggtgtcc
ccactgggctgtgaggtggatgtcgaggagggggacctggggagggactccaagagacgc
aggcttgtgtga

DBGET integrated database retrieval system