KEGG   Homo sapiens (human): 79717Help
Entry
79717             CDS       T01001                                 

Gene name
PPCS, CMD2C
Definition
(RefSeq) phosphopantothenoylcysteine synthetase
  KO
K01922  phosphopantothenate---cysteine ligase (ATP) [EC:6.3.2.51]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00770  Pantothenate and CoA biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    79717 (PPCS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.51  phosphopantothenate---cysteine ligase (ATP)
     79717 (PPCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DFP Collectrin
Motif
Other DBs
NCBI-GeneID: 79717
NCBI-ProteinID: NP_078940
OMIM: 609853
HGNC: 25686
Ensembl: ENSG00000127125
Vega: OTTHUMG00000007332
Pharos: Q9HAB8(Tbio)
UniProt: Q9HAB8
Structure
PDB: 

Position
1p34.2
AA seq 311 aa AA seqDB search
MAEMDPVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNF
SSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEA
EENALPGFAEALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA
VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVI
NRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQ
SRHTAFIGDRN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatggatccggtagccgagttcccccagcctcccggtgctgcgcgctgggct
gaggttatggctcgcttcgcggccaggctgggcgcgcagggccggcgggtggtgttggtt
acgtcaggcggcaccaaggtcccactggaagcgcggccggtgcgcttcctggacaacttc
agcagcgggcggcgcggtgcaacctcggccgaggccttcctagccgccggctacggggtc
ctgttcttgtatcgcgctcgctctgccttcccctatgcccaccgcttcccaccccagact
tggctgtccgctctgcggccttcgggcccagccctttcgggcttgctgagcctggaggcc
gaggagaatgcacttccgggttttgctgaggctctgaggagctaccaggaggctgcggct
gcaggcaccttcctggcagtagagttcaccactttggcggactatttgcatctgttgcag
gctgcggcccaggcactcaatccgctaggcccttctgcgatgttttacctggctgcggct
gtgtcagatttctatgttcctgtctctgaaatgcctgaacacaagatccagtcatctggg
ggcccactgcagataacaatgaagatggtgccaaaactgctttctcctttggttaaagat
tgggctcccaaagcatttataatttcctttaagttggagactgaccccgccattgtaatt
aatcgagctcggaaggctttggaaatttatcagcatcaagtggtggtggctaatatcctt
gagtcacgacagtcctttgtgtttattgtaaccaaagactcggaaaccaagttattgcta
tcagaggaagaaatagaaaaaggcgtagagatagaagagaagatagtggataatcttcag
tctcgacacacagcttttataggtgacagaaactga

DBGET integrated database retrieval system