KEGG   Homo sapiens (human): 79719
Entry
79719             CDS       T01001                                 

Gene name
AAGAB, KPPP1, PPKP1, PPKP1A, p34
Definition
(RefSeq) alpha and gamma adaptin binding protein
  KO
K23878  alpha- and gamma-adaptin-binding protein p34
Organism
hsa  Homo sapiens (human)
Disease
H01404  Punctate palmoplantar keratoderma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79719 (AAGAB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    79719 (AAGAB)
SSDB
Motif
Pfam: Adaptin_binding Ras SCP2_2
Other DBs
NCBI-GeneID: 79719
NCBI-ProteinID: NP_078942
OMIM: 614888
HGNC: 25662
Ensembl: ENSG00000103591
Vega: OTTHUMG00000172246
Pharos: Q6PD74(Tbio)
UniProt: Q6PD74
Position
15q23
AA seq 315 aa
MAAGVPCALVTSCSSVFSGDQLVQHILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINL
CVVPNKFLVTAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAKAWLPEVMILVCDRVSED
GINRQKAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDR
NQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAADSTESLSDHRGGASNTTDAQVDSIVDP
MLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIG
GDRDEIEGLSSDEEH
NT seq 948 nt   +upstreamnt  +downstreamnt
atggctgctggcgtaccctgtgcgttagtcaccagctgctcctccgtcttctcaggagac
cagctggtccaacatatccttggaacagaagatcttattgtggaagtgacttccaatgat
gctgtgagattttatccctggaccattgataataaatactattcagcagacatcaatcta
tgtgtggtgccaaacaaatttcttgttactgcagagattgcagaatctgtccaagcattt
gtggtttactttgacagcacacaaaaatcgggccttgatagtgtctcctcatggcttcca
ctggcaaaagcatggttacctgaggtgatgatcttggtctgcgatagagtgtctgaagat
ggtataaaccgacaaaaagctcaagaatggtgcatcaaacatggctttgaattggtagaa
cttagtccagaggagttgcctgaggaggatgatgacttcccagaatctacaggagtaaag
cgaattgtccaagccctgaatgccaatgtgtggtccaatgtagtgatgaagaatgatagg
aaccaaggctttagccttctcaactcattgactggaacaaaccatagcattgggtcagca
gatccctgtcacccagagcaaccccatttgccagcagcagatagtactgaatccctctct
gatcatcggggtggtgcatctaacacaacagatgcccaggttgatagcattgtggatccc
atgttagatctggatattcaagaattagccagtcttaccactggaggaggagatgtggag
aattttgaaagactcttttcaaagttaaaggaaatgaaagacaaggctgcgacgcttcct
catgagcaaagaaaagtgcatgcagaaaaggtggccaaagcattctggatggcaatcggg
ggagacagagatgaaattgaaggcctttcatctgatgaagagcactga

DBGET integrated database retrieval system