KEGG   Homo sapiens (human): 79727
Entry
79727             CDS       T01001                                 
Symbol
LIN28A, CSDD1, LIN-28, LIN28, ZCCHC1, lin-28A
Name
(RefSeq) lin-28 homolog A
  KO
K18754  protein lin-28
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    79727 (LIN28A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     79727 (LIN28A)
SSDB
Motif
Pfam: CSD zf-CCHC zf-CCHC_6 S1 zf-CCHC_4
Other DBs
NCBI-GeneID: 79727
NCBI-ProteinID: NP_078950
OMIM: 611043
HGNC: 15986
Ensembl: ENSG00000131914
Vega: OTTHUMG00000003550
Pharos: Q9H9Z2(Tbio)
UniProt: Q9H9Z2
Structure
Position
1:26410817..26429728
AA seq 209 aa
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
GPSAQGKPTYFREEEEEIHSPTLLPEAQN
NT seq 630 nt   +upstreamnt  +downstreamnt
atgggctccgtgtccaaccagcagtttgcaggtggctgcgccaaggcggcagaagaggcg
cccgaggaggcgccggaggacgcggcccgggcggcggacgagcctcagctgctgcacggt
gcgggcatctgtaagtggttcaacgtgcgcatggggttcggcttcctgtccatgaccgcc
cgcgccggggtcgcgctcgaccccccagtggatgtctttgtgcaccagagtaagctgcac
atggaagggttccggagcttgaaggagggtgaggcagtggagttcacctttaagaagtca
gccaagggtctggaatccatccgtgtcaccggacctggtggagtattctgtattgggagt
gagaggcggccaaaaggaaagagcatgcagaagcgcagatcaaaaggagacaggtgctac
aactgtggaggtctagatcatcatgccaaggaatgcaagctgccaccccagcccaagaag
tgccacttctgccagagcatcagccatatggtagcctcatgtccgctgaaggcccagcag
ggccctagtgcacagggaaagccaacctactttcgagaggaagaagaagaaatccacagc
cctaccctgctcccggaggcacagaattga

DBGET integrated database retrieval system