KEGG   Homo sapiens (human): 79735
Entry
79735             CDS       T01001                                 

Gene name
TBC1D17
Definition
(RefSeq) TBC1 domain family member 17
  KO
K19945  TBC1 domain family member 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    79735 (TBC1D17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79735 (TBC1D17)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    79735 (TBC1D17)
SSDB
Motif
Pfam: PH_RBD RabGAP-TBC
Other DBs
NCBI-GeneID: 79735
NCBI-ProteinID: NP_078958
OMIM: 616659
HGNC: 25699
Ensembl: ENSG00000104946
Vega: OTTHUMG00000183376
Pharos: Q9HA65(Tdark)
UniProt: Q9HA65
Position
19q13.33
AA seq 648 aa
MEGAGYRVVFEKGGVYLHTSAKKYQDRDSLIAGVIRVVEKDNDVLLHWAPVEEAGDSTQI
LFSKKDSSGGDSCASEEEPTFDPGYEPDWAVISTVRPQLCHSEPTRGAEPSCPQGSWAFS
VSLGELKSIRRSKPGLSWAYLVLVTQAGGSLPALHFHRGGTRALLRVLSRYLLLASSPQD
SRLYLVFPHDSSALSNSFHHLQLFDQDSSNVVSRFLQDPYSTTFSSFSRVTNFFRGALQP
QPEGAASDLPPPPDDEPEPGFEVISCVELGPRPTVERGPPVTEEEWARHVGPEGRLQQVP
ELKNRIFSGGLSPSLRREAWKFLLGYLSWEGTAEEHKAHIRKKTDEYFRMKLQWKSVSPE
QERRNSLLHGYRSLIERDVSRTDRTNKFYEGPENPGLGLLNDILLTYCMYHFDLGYVQGM
SDLLSPILYVIQNEVDAFWCFCGFMELVQGNFEESQETMKRQLGRLLLLLRVLDPLLCDF
LDSQDSGSLCFCFRWLLIWFKREFPFPDVLRLWEVLWTGLPGPNLHLLVACAILDMERDT
LMLSGFGSNEILKHINELTMKLSVEDVLTRAEALHRQLTACPELPHNVQEILGLAPPAEP
HSPSPTASPLPLSPTRAPPTPPPSTDTAPQPDSSLEILPEEEDEGADS
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggaaggagccggctacagggtggtgtttgagaagggcggagtgtacctgcacaccagc
gctaagaagtatcaggaccgagactctctcatcgctggtgtcatccgtgtcgtggaaaag
gacaatgacgtcctcctgcactgggctcctgtagaggaggctggagattccacccaaatc
ctcttctccaagaaggactccagtgggggtgactcatgtgcttctgaggaggaaccaacc
tttgaccccggctatgaacctgactgggctgtcatcagcactgtgcggccacagctctgc
cactcagagcccacgagaggtgcagagcccagctgcccccagggctcctgggccttctca
gtgagtctgggggagctaaagtccatccgccgctccaagccaggcctcagctgggcctac
ctggttctggtgacccaggctggaggttccctgcccgcactgcacttccaccgcgggggc
acccgcgccctgctccgcgtcctcagccgctacctgctgttggccagctccccgcaggac
tcccgcctctaccttgtcttcccccacgactcctctgctctctccaactccttccaccac
ctgcagctctttgaccaggacagctccaatgtggtgtcacgcttcctccaggatccctac
tccaccaccttcagcagcttctcccgagtgaccaacttcttccggggtgccctgcagcca
cagcctgagggagccgcctccgaccttcccccgccacccgacgatgagcccgagcctgga
ttcgaggtcatttcctgtgtggagctggggcctcggccaaccgtggagcggggccctcca
gttacagaggaggagtgggcacgccacgtgggccctgaaggtcgcctgcagcaggtccct
gagctgaagaaccggatcttctcggggggtctgagccccagcctgcggcgcgaggcctgg
aagttcctcctagggtacctcagctgggaaggcacagctgaggagcacaaggcccacata
cgcaagaaaacggatgagtatttccgcatgaagctgcagtggaaatctgtgagccctgag
caggagcggagaaactcacttctgcatggataccgcagcctcatcgaaagggatgtgagc
cgcactgacaggaccaacaagttctacgagggtcccgagaacccggggctgggcctgctg
aacgatatcctcctcacctactgcatgtatcacttcgacctcggctacgtccagggcatg
agtgatcttctctccccgatcctctacgtcattcagaacgaggtggatgctttctggtgt
ttctgtggcttcatggagctcgtgcaagggaactttgaagagagccaggagaccatgaag
cggcaactcgggcgactgctgctgctcctgagggtgctggaccccctgctctgcgacttc
ctggattcccaggactccggctctctctgcttctgtttccggtggctgctcatctggttc
aagagggaattccccttcccggatgtccttcggctgtgggaggtgctgtggacagggctc
cctggccccaatctgcacctgctggtggcctgcgccatcctggacatggagagggacacc
ctcatgctgtccggcttcggctccaatgagatcctcaagcacatcaacgagctgactatg
aagctgagcgtggaggacgtgctgacccgcgccgaggccctgcaccgccagctaaccgcc
tgccccgagctgccccacaacgtgcaggagatcctggggctggccccgcccgcagagccc
cacagcccctcgcccaccgcctccccgctgcctctgtcgcccacccgggccccgcccacc
ccgccgccctccacggacacagccccgcagcccgacagcagcctggagatcctgcccgag
gaggaggacgagggcgccgactcctaa

DBGET integrated database retrieval system