KEGG   Homo sapiens (human): 79748
Entry
79748             CDS       T01001                                 

Symbol
LMAN1L, ERGIC-53L, ERGL
Name
(RefSeq) lectin, mannose binding 1 like
  KO
K10081  lectin, mannose-binding 1-like
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    79748 (LMAN1L)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    79748 (LMAN1L)
Lectins [BR:hsa04091]
 L-type lectins
  79748 (LMAN1L)
SSDB
Motif
Pfam: Lectin_leg-like Bact_lectin
Other DBs
NCBI-GeneID: 79748
NCBI-ProteinID: NP_068591
OMIM: 609548
HGNC: 6632
Ensembl: ENSG00000140506
Vega: OTTHUMG00000142813
Pharos: Q9HAT1(Tbio)
UniProt: Q9HAT1
Position
15q24.1
AA seq 526 aa
MPAVSGPGPLFCLLLLLLDPHSPETGCPPLRRFEYKLSFKGPRLALPGAGIPFWSHHGDA
ILGLEEVRLTPSMRNRSGAVWSRASVPFSAWEVEVQMRVTGLGRRGAQGMAVWYTRGRGH
VGSVLGGLASWDGIGIFFDSPAEDTQDSPAIRVLASDGHIPSEQPGDGASQGLGSCHWDF
RNRPHPFRARITYWGQRLRMSLNSGLTPSDPGEFCVDVGPLLLVPGGFFGVSAATGTLAD
DHDVLSFLTFSLSEPSPEVPPQPFLEMQQLRLARQLEGLWARLGLGTREDVTPKSDSEAQ
GEGERLFDLEETLGRHRRILQALRGLSKQLAQAERQWKKQLGPPGQARPDGGWALDASCQ
IPSTPGRGGHLSMSLNKDSAKVGALLHGQWTLLQALQEMRDAAVRMAAEAQVSYLPVGIE
HHFLELDHILGLLQEELRGPAKAAAKAPRPPGQPPRASSCLQPGIFLFYLLIQTVGFFGY
VHFRQELNKSLQECLSTGSLPLGPAPHTPRALGILRRQPLPASMPA
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgccggcggtcagtggtccaggtcccttattctgccttctcctcctgctcctggacccc
cacagccctgagacggggtgtcctcctctacgcaggtttgagtacaagctcagcttcaaa
ggcccaaggctggcattgcctggggctggaatacccttctggagccatcatggagacgcc
atcctgggcctggaggaagtgcggctgacgccatccatgaggaaccggagtggcgccgtg
tggagcagggcctctgtccccttctctgcctgggaagtagaggtgcagatgagggtgacg
ggactggggcgccggggagcccagggcatggccgtgtggtacacccggggcaggggccat
gtaggctctgtccttggggggctggcttcgtgggacggcatcgggatcttctttgactct
ccggcagaggatactcaggacagtcctgccatccgtgtgctggccagcgacgggcacatc
ccctctgagcagcctggggatggagctagccaagggctgggctcctgtcattgggacttc
cggaaccggccacaccccttcagagcacggatcacctactgggggcagaggctgcgcatg
tccttgaacagtggcctcactcccagtgatccaggtgagttctgtgtggatgtggggccc
ctgcttttggtccctggaggtttctttggggtctcagcagccaccggcaccctggcagat
gatcatgatgtcctgtccttcctgaccttcagcctgagtgagcccagcccagaggttccc
cctcagcccttcctggagatgcagcagctccgcctggcgaggcagctggaagggctgtgg
gcaaggctgggcttgggcaccagggaggatgtaactccaaaatcagactctgaagctcaa
ggagaaggggaaaggctctttgacctggaggagacgctgggcagacaccgccggatcctg
caggctctgcggggtctctccaagcagctggcccaggctgagagacaatggaagaagcag
ctggggcccccaggccaagccaggcctgacggaggctgggccctggatgcttcctgccag
attccatccaccccagggaggggtggccacctctccatgtcactcaataaggactctgcc
aaggtcggtgccctgctccatggacagtggactctgctccaggccctgcaagagatgagg
gatgcagctgtccgcatggctgcagaagcccaggtctcctacctgcctgtgggcattgag
catcatttcttagagctggaccacatcctgggcctcctgcaggaggagcttcggggcccg
gcgaaggcagcagccaaggccccccgcccacctggccagcccccaagggcctcctcgtgc
ctgcagcctggcatcttcctgttctacctcctcattcagactgtaggcttcttcggctac
gtgcacttcaggcaggagctgaacaagagccttcaggagtgtctgtccacaggcagcctt
cctctgggtcctgcaccacacacccccagggccctggggattctgaggaggcagcctctc
cctgccagcatgcctgcctga

DBGET integrated database retrieval system