KEGG   Homo sapiens (human): 7975
Entry
7975              CDS       T01001                                 

Gene name
MAFK, NFE2U, P18
Definition
(RefSeq) MAF bZIP transcription factor K
  KO
K09037  transcription factor MAFF/G/K
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7975 (MAFK)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    7975 (MAFK)
SSDB
Motif
Pfam: bZIP_Maf bZIP_1 DivIC Cnn_1N DUF1192 CALCOCO1 Spc24 FapA PilJ Prominin Spc7 bZIP_2 UPF0242 YabA DASH_Spc19 GIT_CC DUF4164
Other DBs
NCBI-GeneID: 7975
NCBI-ProteinID: NP_002351
OMIM: 600197
HGNC: 6782
Ensembl: ENSG00000198517
Vega: OTTHUMG00000151453
Pharos: O60675(Tbio)
UniProt: O60675 A0A024R804
Position
7p22.3
AA seq 156 aa
MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLK
NRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFART
VARGPVAPSKVATTSVITIVKSTELSSTSVPFSAAS
NT seq 471 nt   +upstreamnt  +downstreamnt
atgacgactaatcccaaaccgaataaggcattaaaggtcaagaaggaggcgggcgagaac
gccccggtgctcagcgatgatgagctggtgtccatgtcggtgcgggagctgaaccagcac
ctgcggggtctcaccaaggaggaggtgacccgcctgaagcagcgtcggcgcacactcaag
aaccgcggctacgcggccagctgccgcatcaagcgggtgacgcagaaggaggagctggag
cggcagcgcgtggagctgcagcaggaggtggagaagctggcgcgtgagaacagcagcatg
cggctggagctggacgccctgcgctccaagtacgaggcgctgcagaccttcgcgcgcacc
gtggcccggggacctgtggcgccctccaaggtggccaccaccagcgtcatcaccatcgtc
aagtccaccgagctctcctccacctccgtgcccttctcggctgcatcctag

DBGET integrated database retrieval system