KEGG   Homo sapiens (human): 79751Help
Entry
79751             CDS       T01001                                 

Gene name
SLC25A22, EIEE3, GC-1, GC1, NET44
Definition
(RefSeq) solute carrier family 25 member 22
  KO
K15107  solute carrier family 25 (mitochondrial glutamate transporter), member 18/22
Organism
hsa  Homo sapiens (human)
Disease
H00606  Early infantile epileptic encephalopathy
H01819  Early myoclonic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    79751 (SLC25A22)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   79751 (SLC25A22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Telomere_reg-2
Motif
Other DBs
NCBI-GeneID: 79751
NCBI-ProteinID: NP_001177989
OMIM: 609302
HGNC: 19954
Ensembl: ENSG00000177542
Vega: OTTHUMG00000133310
Pharos: Q9H936(Tdark)
UniProt: Q9H936
Position
11p15.5
AA seq 323 aa AA seqDB search
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSE
GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
RGIAGLYKGLGATLLRDVPFSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA
VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG
IAQVVYFLGIAESLLGLLQDPQA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctgataagcagatcagcctgccagccaagctcatcaatggcggcatcgccgggctg
atcggtgtcacctgcgtgtttcccatcgacctggccaagaccaggctgcagaaccagcag
aacggccagcgcgtgtacacgagcatgtccgactgcctcatcaagaccgtccgctccgag
ggctacttcggcatgtaccggggagctgctgtgaacttgaccctcgtcacccccgagaag
gccatcaagctggcagccaacgacttcttccgacatcagctctctaaggacgggcagaag
ctgaccctgcttaaagagatgctggcgggctgtggggctggcacctgccaggtgatcgtg
accacgcccatggagatgctgaagatccagctgcaggatgcagggcgcattgccgcccag
aggaagatcctggctgcccagggccagctctcggcccaggggggtgcccagccctcagtg
gaggctccagctgcccctcggcccacggccacccagctgacccgcgacctgctgcggagc
cgtggcattgccggtctctacaagggactcggggccacgctgctcagggatgtccccttc
tctgtggtgtacttcccgctctttgccaacctgaaccagctgggccgcccggcgtccgag
gagaagtcgcctttctacgtgtccttcctggccggctgtgtggctgggagtgccgccgct
gtggccgtcaacccctgtgatgtggtgaagacgcggctccagtcacttcagcgaggcgtc
aacgaggacacctactctgggatcctggactgtgccaggaagatcctgcggcacgagggc
ccctcggccttcctgaagggcgcctactgccgcgcgctggtcatcgcgccccttttcggc
atcgcacaggtggtctacttcctgggcatcgcggagtccctgctggggctgctgcaggac
ccccaggcctga

DBGET integrated database retrieval system