KEGG   Homo sapiens (human): 79754
Entry
79754             CDS       T01001                                 

Gene name
ASB13
Definition
(RefSeq) ankyrin repeat and SOCS box containing 13
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    79754 (ASB13)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     79754 (ASB13)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 SOCS_box
Other DBs
NCBI-GeneID: 79754
NCBI-ProteinID: NP_078977
OMIM: 615055
HGNC: 19765
Ensembl: ENSG00000196372
Vega: OTTHUMG00000017603
Pharos: Q8WXK3(Tdark)
UniProt: Q8WXK3
Position
10p15.1
AA seq 278 aa
MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAAS
LQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASP
LHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAK
LHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPL
TLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
NT seq 837 nt   +upstreamnt  +downstreamnt
atggagccccgggcggcggacggctgcttcctgggcgacgtgggtttctgggtggagcgg
acccctgtgcacgaggcagcccagcggggtgagagcctgcagctgcaacagctgatcgag
agcggcgcctgcgtgaaccaggtcaccgtggactccatcacgcccctgcacgcagccagt
ctgcagggccaggcgcggtgtgtgcagctgctgctggcggctggggcccaggtggatgct
cgcaacatcgacggcagcaccccgctctgcgatgcctgcgcctcgggcagcatcgagtgt
gtgaagctcttgctgtcctacggggccaaggtcaaccctcccctgtacacagcgtccccc
ctgcacgaggcctgcatgagcgggagttccgaatgtgtgaggcttcttattgacgtcggg
gccaatctggaagcgcacgattgccattttgggacccctctgcacgttgcctgtgcccgg
gagcatctggactgtgtcaaagtgctgctcaatgcaggggccaacgtgaatgcggcaaag
cttcatgagactgcccttcaccacgcggccaaggtcaagaatgttgacctcatcgagatg
cttatcgagtttggcggcaacatctacgcccgggacaaccgcgggaagaagccgtctgac
tacacgtggagcagcagcgctcccgccaagtgcttcgagtactacgaaaagacacctctg
actctgtcacagctctgcagggtgaacttgaggaaggccactggcgtccgagggctggag
aagattgccaagttaaacatcccgccccggctcattgattacctctcctacaactga

DBGET integrated database retrieval system