KEGG   Homo sapiens (human): 79759Help
Entry
79759             CDS       T01001                                 

Gene name
ZNF668
Definition
(RefSeq) zinc finger protein 668
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf_UBZ zf-met Zn-ribbon_8 zf-C2H2_11 C1_4 zinc_ribbon_15 zf-C2HC_2 zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 79759
NCBI-ProteinID: NP_001166139
OMIM: 617103
HGNC: 25821
Ensembl: ENSG00000167394
Vega: OTTHUMG00000047357
Pharos: Q96K58(Tdark)
UniProt: Q96K58 A0A024QZD9 A8K1I4
Position
16p11.2
AA seq 619 aa AA seqDB search
MEVEAAEARSPAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHGPADCSEEVAEVKPKP
ETEAKAEEASGEKVSGSAAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRR
FMQPVCLRVHLASHAGELPFRCAHCPKAYGALSKLKIHQRGHTGERPYACADCGKSFADP
SVFRKHRRTHAGLRPYSCERCGKAYAELKDLRNHERSHTGERPFLCSECGKSFSRSSSLT
CHQRIHAAQKPYRCPACGKGFTQLSSYQSHERTHSGEKPFLCPRCGRMFSDPSSFRRHQR
AHEGVKPYHCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHALVHSG
QRPFRCEECGRAFAERASLTKHSRVHSGERPFHCNACGKSFVVSSSLRKHERTHRSSEAA
GVPPAQELVVGLALPVGVAGESSAAPAAGAGLGDPPAGLLGLPPESGGVMATQWQVVGMT
VEHVECQDAGVREAPGPLEGAGEAGGEEADEKPPQFVCRECKETFSTMTLLRRHERSHPE
LRPFPCTQCGKSFSDRAGLRKHSRTHSSVRPYTCPHCPKAFLSASDLRKHERTHPVPMGT
PTPLEPLVALLGMPEEGPA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggaggctgcagaggcccggtccccagcccccggctacaagcgctcgggccgc
cgctacaagtgcctgtcctgtaccaagacatttccaaacgcgcccagggcagcgcgccac
gctgccacacatgggccggcagactgctctgaagaggtggccgaggtgaagccaaagcca
gagacagaagctaaggcagaggaagccagtggggagaaggtgtcaggctccgcggccaag
cctaggccctatgcgtgtccgctatgccccaaggcctacaagacggcacccgagctgcgc
agccacgggcgcagccacacgggggagaagccctttccgtgccccgagtgcggccgccgc
ttcatgcagcccgtgtgcctgcgcgtgcacctggcctcgcacgctggcgaactgcccttc
cgctgtgcgcactgcccgaaggcctatggcgcgctctccaagctcaagatccaccagcgt
ggccacacaggcgagcggccttacgcctgcgccgactgcggcaagagctttgctgaccct
tcagtgttccgcaagcaccggcgtactcacgctggcctgcggccctacagctgtgagcgt
tgcggcaaagcctatgcggagctcaaggacctccgcaaccatgagcggtcccacaccggc
gagcgccccttcctctgctccgagtgcgggaagagcttctcccgctcatcctcgctcacg
tgccaccagcgcatccacgcggcacagaagccctaccgctgcccggcctgcggcaagggc
ttcacgcagctcagttcctaccagagccacgagcgcacgcactcgggggagaagcccttc
ctgtgcccgcgctgcggccgcatgttctccgacccctcgagcttccgtcgccaccagcgc
gcccatgaaggggtgaagccataccactgcgagaagtgcggcaaggacttccggcagccg
gcggacctggccatgcaccggcgtgtgcacacaggcgaccggccgttcaagtgcctgcaa
tgtgacaagacgttcgtggcgtcctgggacctcaagcggcacgcgctggtgcactctggc
cagcggcccttccgctgtgaggagtgcgggcgagccttcgccgagcgtgccagcctcacg
aagcatagccgggtgcactcgggggagcgccccttccactgtaacgcatgtgggaaatcc
tttgtggtgtcgtcgagcctgaggaagcacgagcggacccatcgaagcagtgaggccgcg
ggtgtgccccctgcacaggagctggtggtggggttggcgctgcctgtgggcgtggcaggt
gagagttcagccgccccggcagcaggggcggggctgggggaccctccagcagggctgcta
gggctgcccccggagtcaggtggtgtgatggccacacagtggcaggtggtgggcatgacg
gtggagcatgtggaatgccaagatgctggtgtccgggaggctcctggtcccttggaaggg
gcaggcgaggcggggggtgaggaggctgacgagaagcccccccagtttgtgtgccgagag
tgcaaggagaccttctccacaatgacgctgctgcgtcggcacgagcgctcacacccggag
ctccggcccttcccctgcacccagtgcggcaagagcttctctgaccgggctgggctgcgc
aaacacagccgcactcacagctcagtgcgcccctacacctgcccccattgtcccaaggcc
ttcttgagtgccagcgacttgcgcaagcatgaacgcacccaccctgtgcccatggggacc
cccacacccctggagcccctggtggctttgctaggaatgcctgaagaggggccggcctga

DBGET integrated database retrieval system