KEGG   Homo sapiens (human): 79774Help
Entry
79774             CDS       T01001                                 

Gene name
GRTP1, TBC1D6
Definition
(RefSeq) growth hormone regulated TBC protein 1
  KO
K19953  TBC1 domain family member 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    79774 (GRTP1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    79774 (GRTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC
Motif
Other DBs
NCBI-GeneID: 79774
NCBI-ProteinID: NP_078995
HGNC: 20310
Ensembl: ENSG00000139835
Vega: OTTHUMG00000017381
Pharos: Q5TC63(Tdark)
UniProt: Q5TC63
Position
13q34
AA seq 336 aa AA seqDB search
MQPAERSRVPRIDPYGFERPEDFDDAAYEKFFSSYLVTLTRRAIKWSRLLQGGGVPRSRT
VKRYVRKGVPLEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLEDAIRTDLNRTFP
DNVKFRKTTDPCLQRTLYNVLLAYGHHNQGVGYCQGMNFIAGYLILITNNEEESFWLLDA
LVGRILPDYYSPAMLGLKTDQEVLGELVRAKLPAVGALMERLGVLWTLLVSRWFICLFVD
ILPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQELILEATSVPDICDKFKQITKGSFVM
ECHTFMQKIFSEPGSLSMATVAKLRESCRARLLAQG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccgccgagcgctcgcgggtccccaggatcgacccgtacggattcgagcggcct
gaggacttcgacgacgccgcctacgagaagtttttctccagctacctggtcacgctcacc
cgcagggcgatcaaatggtcccggctgctgcagggcgggggcgtccccaggagccggaca
gtgaagcgctatgtccggaaaggggtcccgctggagcaccgtgcccgcgtctggatggtg
ctgagtggggcccaggcgcagatggaccagaatcccggctactaccaccagcttctccag
ggagagagaaaccccaggctggaggacgccatcaggacagacctgaaccggaccttcccc
gacaacgtgaagttccggaagaccacggacccctgcttacagaggaccctgtacaatgtg
ctgctggcatatgggcaccataaccagggagtgggctactgccagggaatgaattttata
gcaggatatctgattcttataacaaataatgaagaagaatctttttggctgttagatgct
cttgttggaagaatactaccagattactacagcccggccatgctgggcctgaagaccgac
caggaggtcctcggggagctggtgcgggcgaagctgccggctgtgggggccctgatggag
cgtctcggtgtgctgtggacgctgctggtgtcccgctggttcatctgcctgtttgtggac
atcttgcccgtggagacagtgcttcggatctgggactgtttgtttaacgaaggctcgaag
attatcttccgggtggccctgaccttaattaagcagcaccaggagttgattttggaagcc
accagcgttccagacatttgcgataagtttaagcagataaccaaagggagtttcgtgatg
gagtgtcacacgtttatgcagaaaatattttcagaacctggaagcttatccatggccacc
gtcgccaagctccgcgagagctgcagggcccggctgctggcacaggggtga

DBGET integrated database retrieval system