KEGG   Homo sapiens (human): 79780
Entry
79780             CDS       T01001                                 
Symbol
CCDC82, HSPC048
Name
(RefSeq) coiled-coil domain containing 82
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4196 DUF4211
Other DBs
NCBI-GeneID: 79780
NCBI-ProteinID: NP_001305665
OMIM: 619870
HGNC: 26282
Ensembl: ENSG00000149231
Pharos: Q8N4S0(Tdark)
UniProt: Q8N4S0 A0A024R3B3
Position
11:complement(96352773..96389912)
AA seq 544 aa
MIHVRRHETRRNSKSHVPEQKSRVDWRRTKRSSISQLLDSDEELDSEEFDSDEELDSDES
FENDEELDSNKGPDCNKTPGSERELNLSKIQSEGNDSKCLINSGNGSTYEEETNKIKHRN
IDLQDQEKHLSQEDNDLNKQTGQIIEDDQEKHLSQEDNDLNKQTGQIIEDDLEEEDIKRG
KRKRLSSVMCDSDESDDSDILVRKVGVKRPRRVVEDEGSSVEMEQKTPEKTLAAQKREKL
QKLKELSKQRSRQRRSSGRDFEDSEKESCPSSDEVDEEEEEDNYESDEDGDDYIIDDFVV
QDEEGDEENKNQQGEKLTTSQLKLVKQNSLYSFSDHYTHFERVVKALLINALDESFLGTL
YDGTRQKSYAKDMLTSLHYLDNRFVQPRLESLVSRSRWKEQYKERVENYSNVSIHLKNPE
NCSCQACGLHRYCKYSVHLSGELYNTRTMQIDNFMSHDKQVFTVGRICASRTRIYHKLKH
FKFKLYQECCTIAMTEEVEDEQVKETVERIFRRSKENGWIKEKYGQLEEYLNFADYFQEE
KFEL
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgatacatgttagaagacatgaaacaaggagaaattctaagagtcacgtgcctgagcag
aaatctcgagttgattggaggcgaactaaaagaagtagtatctcacaattacttgatagt
gatgaagagcttgatagtgaagaatttgatagtgatgaagagcttgatagtgatgaaagt
tttgaaaatgatgaagagcttgatagtaacaagggacctgattgtaataaaacaccagga
agtgaaagagagctcaacttaagtaaaattcaaagtgaaggaaatgacagtaagtgtctc
attaactctggcaacggttcaacatatgaagaagaaacgaacaaaatcaaacataggaat
attgacttacaagatcaggaaaaacatttaagtcaagaggataatgatctcaacaaacaa
actggacaaataatagaggatgatcaggaaaaacatttaagtcaagaggataatgatctc
aacaaacaaactggacaaataatagaggatgatttagaagaagaagacatcaagcgagga
aaaagaaaaaggctatcctctgtgatgtgtgacagtgatgagagtgatgacagcgatatc
ctagttagaaaagtaggtgttaaacgtccccgtagagtggttgaagatgaaggttcttca
gtggaaatggagcaaaagactcctgaaaaaacattagctgcacaaaagcgagaaaaactt
cagaagctcaaagaactctcaaaacaaagatctcgtcagagacgcagtagtggtagagat
tttgaggactctgaaaaggaatcttgcccaagcagtgatgaagttgatgaggaggaagaa
gaggataattatgaatctgatgaagatggagatgattatattatcgatgactttgtagtg
caagatgaggagggtgatgaagagaataaaaaccaacaaggagaaaaattgactacatca
caactgaaattagtaaaacagaattctctttattcttttagtgaccactatactcatttt
gaaagagttgtgaaggctcttctgatcaacgctttagatgaatcttttctgggaacatta
tatgatggcacaaggcaaaaatcatatgcaaaagatatgctaacatctcttcattatttg
gataaccgctttgttcagcctcgtctagagagcttggtatctagaagtcgttggaaagag
caatataaggagcgagtagaaaattattctaatgtaagtattcatttgaagaatcctgaa
aactgttcctgccaggcttgtggactgcatcgctactgtaaatattcagtgcatttatca
ggagagttgtataacaccaggaccatgcaaatagataatttcatgtcacatgataaacag
gtgttcactgttggcagaatttgtgccagccgtaccagaatttatcataaactgaaacat
tttaaattcaaactataccaggaatgttgcaccattgcaatgacagaagaagttgaagat
gaacaagttaaagaaacagtggaaagaattttcaggcggtcaaaagaaaatggctggatt
aaggagaaatatggtcaacttgaagaatatctcaattttgcggattactttcaagaagag
aagtttgagttgtaa

DBGET integrated database retrieval system