KEGG   Homo sapiens (human): 7979Help
Entry
7979              CDS       T01001                                 

Gene name
SEM1, C7orf76, DSS1, ECD, SHFD1, SHFM1, SHSF1, Shfdg1
Definition
(RefSeq) SEM1 26S proteasome complex subunit
  KO
K10881  26 proteasome complex subunit DSS1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa03440  Homologous recombination
hsa05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    7979 (SEM1)
  09124 Replication and repair
   03440 Homologous recombination
    7979 (SEM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    7979 (SEM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7979 (SEM1)
   03051 Proteasome [BR:hsa03051]
    7979 (SEM1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7979 (SEM1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    7979 (SEM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     7979 (SEM1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     7979 (SEM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSS1_SEM1
Motif
Other DBs
NCBI-GeneID: 7979
NCBI-ProteinID: NP_006295
OMIM: 601285
HGNC: 10845
Ensembl: ENSG00000127922
Vega: OTTHUMG00000150680
Pharos: P60896(Tbio)
UniProt: P60896 Q6IBB7
Structure
PDB: 

Position
7q21.3
AA seq 70 aa AA seqDB search
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaaaaagcagccggtagacttaggtctgttagaggaagacgacgagtttgaa
gagttccctgccgaagactgggctggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaggatgacttctctaatcagttacgagctgaacta
gagaaacatggttataagatggagacttcatag

DBGET integrated database retrieval system