KEGG   Homo sapiens (human): 7979
Entry
7979              CDS       T01001                                 

Gene name
SEM1, C7orf76, DSS1, ECD, SHFD1, SHFM1, SHSF1, Shfdg1
Definition
(RefSeq) SEM1 26S proteasome complex subunit
  KO
K10881  26 proteasome complex subunit DSS1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa03440  Homologous recombination
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05169  Epstein-Barr virus infection
Network
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01029  26S proteasome-mediated protein degradation
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
N01061  Mutation-caused aberrant Htt to 26S proteasome-mediated protein degradation
N01144  Mutation-caused aberrant SOD1 to 26S proteasome-mediated protein degradation
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01146  Mutation-inactivated UBQLN2 to 26S proteasome-mediated protein degradation
N01197  Scrapie conformation PrPSc to 26S proteasome-mediated protein degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    7979 (SEM1)
  09124 Replication and repair
   03440 Homologous recombination
    7979 (SEM1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    7979 (SEM1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7979 (SEM1)
   05012 Parkinson disease
    7979 (SEM1)
   05014 Amyotrophic lateral sclerosis
    7979 (SEM1)
   05016 Huntington disease
    7979 (SEM1)
   05017 Spinocerebellar ataxia
    7979 (SEM1)
   05020 Prion disease
    7979 (SEM1)
   05022 Pathways of neurodegeneration - multiple diseases
    7979 (SEM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7979 (SEM1)
   04131 Membrane trafficking [BR:hsa04131]
    7979 (SEM1)
   03051 Proteasome [BR:hsa03051]
    7979 (SEM1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7979 (SEM1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX-2 complex
     7979 (SEM1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    7979 (SEM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     7979 (SEM1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     7979 (SEM1)
SSDB
Motif
Pfam: DSS1_SEM1
Other DBs
NCBI-GeneID: 7979
NCBI-ProteinID: NP_006295
OMIM: 601285
HGNC: 10845
Ensembl: ENSG00000127922
Vega: OTTHUMG00000150680
Pharos: P60896(Tbio)
UniProt: P60896 Q6IBB7
Structure
PDB: 

Position
7q21.3
AA seq 70 aa
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAEL
EKHGYKMETS
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtcagagaaaaagcagccggtagacttaggtctgttagaggaagacgacgagtttgaa
gagttccctgccgaagactgggctggcttagatgaagatgaagatgcacatgtctgggag
gataattgggatgatgacaatgtagaggatgacttctctaatcagttacgagctgaacta
gagaaacatggttataagatggagacttcatag

DBGET integrated database retrieval system