KEGG   Homo sapiens (human): 79792Help
Entry
79792             CDS       T01001                                 

Gene name
GSDMD, DF5L, DFNA5L, FKSG10, GSDMDC1
Definition
(RefSeq) gasdermin D
  KO
K20917  gasdermin-D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    79792 (GSDMD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    79792 (GSDMD)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   79792 (GSDMD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gasdermin Gasdermin_C
Motif
Other DBs
NCBI-GeneID: 79792
NCBI-ProteinID: NP_001159709
OMIM: 617042
HGNC: 25697
Ensembl: ENSG00000104518
Vega: OTTHUMG00000165132
Pharos: P57764(Tdark)
UniProt: P57764
Structure
PDB: 

Position
8q24.3
AA seq 484 aa AA seqDB search
MGSAFERVVRRVVQELDHGGEFIPVTSLQSSTGFQPYCLVVRKPSSSWFWKPRYKCVNLS
IKDILEPDAAEPDVQRGRSFHFYDAMDGQIQGSVELAAPGQAKIAGGAAVSDSSSTSMNV
YSLSVDPNTWQTLLHERHLRQPEHKVLQQLRSRGDNVYVVTEVLQTQKEVEVTRTHKREG
SGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTF
QPPATGHKRSTSEGAWPQLPSGLSMMRCLHNFLTDGVPAEGAFTEDFQGLRAEVETISKE
LELLDRELCQLLLEGLEGVLRDQLALRALEEALEQGQSLGPVEPLDGPAGAVLECLVLSS
GMLVPELAIPVVYLLGALTMLSETQHKLLAEALESQTLLGPLELVGSLLEQSAPWQERST
MSLPPGLLGNSWGEGAPAWVLLDECGLELGEDTPHVCWEPQAQGRMCALYASLALLSGLS
QEPH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggcctttgagcgggtagtccggagagtggtccaggagctggaccatggtggg
gagttcatccctgtgaccagcctgcagagctccactggcttccagccctactgcctggtg
gttaggaagccctcaagctcatggttctggaaaccccgttataagtgtgtcaacctgtct
atcaaggacatcctggagccggatgccgcggaaccagacgtgcagcgtggcaggagcttc
cacttctacgatgccatggatgggcagatacagggcagcgtggagctggcagccccagga
caggcaaagatcgcaggcggggccgcggtgtctgacagctccagcacctcaatgaatgtg
tactcgctgagtgtggaccctaacacctggcagactctgctccatgagaggcacctgcgg
cagccagaacacaaagtcctgcagcagctgcgcagccgcggggacaacgtgtacgtggtg
actgaggtgctgcagacacagaaggaggtggaagtcacgcgcacccacaagcgggagggc
tcgggccggttttccctgcccggagccacgtgcttgcagggtgagggccagggccatctg
agccagaagaagacggtcaccatcccctcaggcagcaccctcgcattccgggtggcccag
ctggttattgactctgacttggacgtccttctcttcccggataagaagcagaggaccttc
cagccacccgcgacaggccacaagcgttccacgagcgaaggcgcctggccacagctgccc
tctggcctctccatgatgaggtgcctccacaacttcctgacagatggggtccctgcggag
ggggcgttcactgaagacttccagggcctacgggcagaggtggagaccatctccaaggaa
ctggagcttttggacagagagctgtgccagctgctgctggagggcctggagggggtgctg
cgggaccagctggccctgcgagccttggaggaggcgctggagcagggccagagccttggg
ccggtggagcccctggacggtccagcaggtgctgtcctggagtgcctggtgttgtcctcc
ggaatgctggtgccggaactcgctatccctgttgtctacctgctgggggcactgaccatg
ctgagtgaaacgcagcacaagctgctggcggaggcgctggagtcgcagaccctgttgggg
ccgctcgagctggtgggcagcctcttggagcagagtgccccgtggcaggagcgcagcacc
atgtccctgccccccgggctcctggggaacagctggggcgaaggagcaccggcctgggtc
ttgctggacgagtgtggcctagagctgggggaggacactccccacgtgtgctgggagccg
caggcccagggccgcatgtgtgcactctacgcctccctggcactgctatcaggactgagc
caggagccccactag

DBGET integrated database retrieval system