KEGG   Homo sapiens (human): 79797Help
Entry
79797             CDS       T01001                                 

Gene name
ZNF408, EVR6, RP72
Definition
(RefSeq) zinc finger protein 408
Organism
hsa  Homo sapiens (human)
Disease
H00527  Retinitis pigmentosa
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 zf-met zf-Di19 Zn-ribbon_8 DZR zf-C2HE Zn_ribbon_SprT GAGA zinc-ribbons_6
Motif
Other DBs
NCBI-GeneID: 79797
NCBI-ProteinID: NP_079017
OMIM: 616454
HGNC: 20041
Ensembl: ENSG00000175213
Vega: OTTHUMG00000166568
Pharos: Q9H9D4(Tdark)
UniProt: Q9H9D4
Position
11p11.2
AA seq 720 aa AA seqDB search
MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGLKDVPPEPTRDILALKSLPRG
LALGPSLAKEQRLGVWCVGDPLQPGLLWGPLEEESASKEKGEGVKPRQEENLSLGPWGDV
CACEQSSGWTSLVQRGRLESEGNVAPVRISERLHLQVYQLVLPGSELLLWPQPSSEGPSL
TQPGLDKEAAVAVVTEVESAVQQEVASPGEDAAEPCIDPGSQSPSGIQAENMVSPGLKFP
TQDRISKDSQPLGPLLQDGDVDEECPAQAQMPPELQSNSATQQDPDGSGASFSSSARGTQ
PHGYLAKKLHSPSDQCPPRAKTPEPGAQQSGFPTLSRSPPGPAGSSPKQGRRYRCGECGK
AFLQLCHLKKHAFVHTGHKPFLCTECGKSYSSEESFKAHMLGHRGVRPFPCPQCDKAYGT
QRDLKEHQVVHSGARPFACDQCGKAFARRPSLRLHRKTHQVPAAPAPCPCPVCGRPLANQ
GSLRNHMRLHTGEKPFLCPHCGRAFRQRGNLRGHLRLHTGERPYRCPHCADAFPQLPELR
RHLISHTGEAHLCPVCGKALRDPHTLRAHERLHSGERPFPCPQCGRAYTLATKLRRHLKS
HLEDKPYRCPTCGMGYTLPQSLRRHQLSHRPEAPCSPPSVPSAASEPTVVLLQAEPQLLD
THREEEVSPARDVVEVTISESQEKCFVVPEEPDAAPSLVLIHKDMGLGAWAEVVEVEMGT
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcggaggagctgctcttggaggggaagaaggcgctgcaactcgcccgcgag
ccgcgcctgggcctggacttaggatggaacccttccggagaaggctgtacgcagggcctc
aaagacgtcccacccgagccgacccgagacatcctcgctttaaagagccttccccggggc
ttggcccttggcccctcactcgccaaggaacagcgcttgggggtctggtgtgtcggggac
cccctgcagcccggcctgctgtgggggccgctggaagaggagtctgcctccaaggagaag
ggcgagggagtaaagccacggcaggaggagaacctgtcattaggcccatggggagacgtg
tgtgcctgtgagcagagttctggctggactagcttggtacaacggggcaggctggagagt
gagggaaatgtggccccagtgcggatcagcgagaggcttcatctgcaagtgtaccagctg
gtgctgccaggctctgaactgctgctgtggccccagccttcctctgagggcccaagtctc
acccagcctgggctggacaaagaggcagctgtagcagtggtgacagaagtggagtctgct
gtacagcaggaagtggcctcccctggggaggatgcagcagaaccttgcatagatcctggt
tcccagtcaccctctggcatccaggcagagaatatggtgagccctggacttaagttccca
acccaggaccgaatttccaaggatagccagccacttggcccattgcttcaggatggcgac
gtggatgaggaatgcccggcccaggcacagatgccacctgaacttcagagcaattcggct
acccagcaggacccagatggcagtggagccagtttctcatcttctgccaggggcacccag
ccgcatggctacctggccaagaagttacacagccccagtgatcagtgcccacccagagca
aagaccccagagcctggagcccagcagtctggcttccctacactctcgcggagccctcct
ggcccagcaggaagctccccaaagcaggggcgacggtaccggtgtggagagtgtggcaag
gcattcctacagctgtgccacctaaagaagcacgcatttgtgcacacgggccacaagccc
tttctttgcactgagtgtggcaagagctatagctcagaggagagcttcaaagcccatatg
ctgggccaccgtggggtgcggcccttcccctgtccacaatgcgacaaggcctatggcacc
cagcgagacctcaaagagcaccaggtggtacattcaggtgcccggccctttgcttgtgac
cagtgtggcaaggcctttgcccgccggccctccctgcggctgcatcgcaagacccaccag
gtgccagctgcccctgccccttgcccatgccctgtgtgtgggcggcccctggccaaccag
ggctccctgcggaaccatatgaggctccatacaggagaaaagcctttcctgtgcccgcac
tgtggccgggcgtttcgtcagcggggcaacctgcgtgggcatttgcggctccacaccggg
gagcgtccttaccgctgcccacactgtgccgatgccttcccccagctgcctgaactgcgg
cgccatctcatctcacacaccggggaggcccacttgtgcccggtgtgtggcaaggccctc
cgagacccacacacgctccgagctcacgagcgcctgcactccggagagaggccctttccc
tgtccccagtgtggccgtgcttacacgctggccaccaagctgcggcgccacctcaaatct
cacttggaggacaagccctaccgctgccccacctgtggcatgggctacaccctcccgcag
agcctcaggcggcatcagctcagtcaccggcctgaggcaccctgcagcccaccctctgtg
ccttctgctgcttctgagcccactgtggtgctcctgcaggctgagccacaactgctggac
acacacagagaggaggaagtctcccccgccagggatgttgttgaggtcaccatttcagaa
agccaggagaagtgctttgtggtgccagaggagccagatgccgcccccagcctggtgcta
atccataaggacatgggcctcggcgcctgggcagaggtggtggaggtggagatgggcacc
tga

DBGET integrated database retrieval system