KEGG   Homo sapiens (human): 7980Help
Entry
7980              CDS       T01001                                 

Gene name
TFPI2, PP5, REF1, TFPI-2
Definition
(RefSeq) tissue factor pathway inhibitor 2
  KO
K23087   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Kunitz_BPTI
Motif
Other DBs
NCBI-GeneID: 7980
NCBI-ProteinID: NP_006519
OMIM: 600033
HGNC: 11761
Ensembl: ENSG00000105825
Vega: OTTHUMG00000022963
Pharos: P48307(Tbio)
UniProt: P48307
Structure
PDB: 

Position
7q21.3
AA seq 235 aa AA seqDB search
MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQS
CRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSM
TCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRY
RTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgctcgccccctggggctgtcgattctgctgcttttcctgacggaggctgca
ctgggcgatgctgctcaggagccaacaggaaataacgcggagatctgtctcctgccccta
gactacggaccctgccgggccctacttctccgttactactacgacaggtacacgcagagc
tgccgccagttcctgtacgggggctgcgagggcaacgccaacaatttctacacctgggag
gcttgcgacgatgcttgctggaggatagaaaaagttcccaaagtttgccggctgcaagtg
agtgtggacgaccagtgtgaggggtccacagaaaagtatttctttaatctaagttccatg
acatgtgaaaaattcttttccggtgggtgtcaccggaaccggattgagaacaggtttcca
gatgaagctacttgtatgggcttctgcgcaccaaagaaaattccatcattttgctacagt
ccaaaagatgagggactgtgctctgccaatgtgactcgctattattttaatccaagatac
agaacctgtgatgctttcacctatactggctgtggagggaatgacaataactttgttagc
agggaggattgcaaacgtgcatgtgcaaaagctttgaaaaagaaaaagaagatgccaaag
cttcgctttgccagtagaatccggaaaattcggaagaagcaattttaa

DBGET integrated database retrieval system