KEGG   Homo sapiens (human): 79817
Entry
79817             CDS       T01001                                 
Symbol
MOB3B, C9orf35, MOB1D, MOBKL2B
Name
(RefSeq) MOB kinase activator 3B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 79817
NCBI-ProteinID: NP_079037
OMIM: 617652
HGNC: 23825
Ensembl: ENSG00000120162
Pharos: Q86TA1(Tbio)
UniProt: Q86TA1
Position
9:complement(27325209..27529814)
AA seq 216 aa
MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWV
AVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNL
LMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEA
HVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH
NT seq 651 nt   +upstreamnt  +downstreamnt
atgtccatagccctgaagcaggtattcaacaaggacaagaccttccgacccaagaggaaa
tttgaacctggcacacagaggtttgagctgcacaaacgggctcaggcatccctcaactcg
ggtgtggacctgaaggcggctgtgcagttgcccagtggggaggaccagaatgactgggtg
gcagtacatgtggtggacttcttcaatcggatcaacctcatctatggcaccatctgtgag
ttctgcaccgagcggacctgtcctgtgatgtcagggggccccaaatatgagtatcggtgg
caggatgatctcaagtataagaagccaacagcgctgccagctccccagtacatgaacctt
cttatggattggattgaggttcagatcaacaacgaggaaatatttccaacatgcgtgggt
gttcccttcccaaagaacttccttcagatctgcaagaagatcctgtgccgccttttccgg
gtctttgtccacgtctatatccaccacttcgaccgggtcattgtgatgggtgcagaggcc
catgtcaacacctgctacaaacacttctattactttgtcacagagatgaacctcatagac
cgcaaggagctagagcctttgaaagaaatgacgagcaggatgtgtcactaa

DBGET integrated database retrieval system