KEGG   Homo sapiens (human): 79829
Entry
79829             CDS       T01001                                 
Symbol
NAA40, NAT11, NatD, PATT1, hNatD
Name
(RefSeq) N-alpha-acetyltransferase 40, NatD catalytic subunit
  KO
K20794  N-alpha-acetyltransferase 40 [EC:2.3.1.257]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79829 (NAA40)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.257  N-terminal L-serine Nalpha-acetyltransferase NatD
     79829 (NAA40)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    79829 (NAA40)
SSDB
Motif
Pfam: Acetyltransf_1 FR47 Acetyltransf_7 Glyco_transf_17
Other DBs
NCBI-GeneID: 79829
NCBI-ProteinID: NP_079047
OMIM: 619999
HGNC: 25845
Ensembl: ENSG00000110583
UniProt: Q86UY6
Structure
Position
11:63939002..63957319
AA seq 237 aa
MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECK
RVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVA
FSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTVFKHNH
GAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILSRRTKFGDSHHSHAGGHCGGCCH
NT seq 714 nt   +upstreamnt  +downstreamnt
atggggagaaagtcaagcaaagccaaggagaagaagcagaagcggttggaggagcgagca
gccatggatgccgtttgtgccaaagtggacgctgccaacaggcttggagaccctctggag
gctttcccagtgttcaagaaatatgatagaaacgggttgaatgtctccattgaatgtaag
cgagtgtctggactggagccagccaccgtggattgggccttcgacctgaccaaaacgaat
atgcaaaccatgtatgagcagagcgagtggggctggaaggaccgagagaaacgggaggaa
atgacagatgaccgagcctggtacctcatcgcgtgggaaaacagctccgtccctgttgcc
ttttctcacttccggtttgacgtggagtgtggggatgaagtcctgtactgctatgaagtg
cagttggaaagcaaggtgcggcggaaaggcctggggaagttcctcatacagatcctgcag
ctcatggccaacagcacacagatgaagaaggttatgttaacagtatttaaacacaatcat
ggtgcctaccagttcttcagagaagcgttgcaatttgaaattgatgactcttcccccagc
atgtccggttgctgtggggaggattgctcctatgagatcctgagccggaggaccaagttt
ggggacagccatcactcccacgcgggtgggcactgtggtggctgctgccactga

DBGET integrated database retrieval system