KEGG   Homo sapiens (human): 79833
Entry
79833             CDS       T01001                                 

Gene name
GEMIN6
Definition
(RefSeq) gem nuclear organelle associated protein 6
  KO
K13134  gem associated protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    79833 (GEMIN6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    79833 (GEMIN6)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    79833 (GEMIN6)
SSDB
Motif
Pfam: Gemin6 AD Ish1
Other DBs
NCBI-GeneID: 79833
NCBI-ProteinID: NP_079051
OMIM: 607006
HGNC: 20044
Ensembl: ENSG00000152147
Vega: OTTHUMG00000128588
Pharos: Q8WXD5(Tbio)
UniProt: Q8WXD5
Structure
PDB: 
1Y96

Position
2p22.1
AA seq 167 aa
MSEWMKKGPLEWQDYIYKEVRVTASEKNEYKGWVLTTDPVSANIVLVNFLEDGSMSVTGI
MGHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQ
GDAPRTLCVAGVLTIDPPYGPENCSSSNEIILSRVQDLIEGHLTASQ
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagtgaatggatgaagaaaggccccttagaatggcaagattacatttacaaagaggtc
cgagtgacagccagtgagaagaatgagtataaaggatgggttttaactacagacccagtc
tctgccaatattgtccttgtgaacttccttgaagatggcagcatgtctgtgaccggaatt
atgggacatgctgtgcagactgttgaaactatgaatgaaggggaccatagagtgagggag
aagctgatgcatttgttcacgtctggagactgcaaagcatacagcccagaggatctggaa
gagagaaagaacagcctaaagaaatggcttgagaagaaccacatccccatcactgaacag
ggagacgctccaaggactctctgtgtggctggggtcctgactatagacccaccatatggt
ccagaaaattgcagcagctctaatgagattattctgtcgcgtgttcaggatcttattgaa
ggacatcttacagcttcccaatga

DBGET integrated database retrieval system