KEGG   Homo sapiens (human): 79834Help
Entry
79834             CDS       T01001                                 

Gene name
PEAK1, SGK269
Definition
(RefSeq) pseudopodium enriched atypical kinase 1
  KO
K17538  pseudopodium-enriched atypical kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    79834 (PEAK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     79834 (PEAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NKF3 family
   79834 (PEAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 79834
NCBI-ProteinID: NP_079052
OMIM: 614248
HGNC: 29431
Ensembl: ENSG00000173517
Vega: OTTHUMG00000172618
Pharos: Q9H792(Tbio)
UniProt: Q9H792
Structure
PDB: 

Position
15q24.3
AA seq 1746 aa AA seqDB search
MSACNTFTEHVWKPGECKNCFKPKSLHQLPPDPEKAPITHGNVKTNANHSNNHRIRNTGN
FRPPVAKKPTIAVKPTMIVADGQSICGELSIQEHCENKPVIIGWNRNRAALSQKPLNNNN
EDDEGISHVPKPYGNNDSAKKMSDNNNGLTEVLKEIAGLDTAPQIRGNETNSRETFLGRI
NDCYKRSLERKLPPSCMIGGIKETQGKHVILSGSTEVISNEGGRFCYPEFSSGEESEEDV
LFSNMEEEHESWDESDEELLAMEIRMRGQPRFANFRANTLSPVRFFVDKKWNTIPLRNKS
LQRICAVDYDDSYDEILNGYEENSVVSYGQGSIQSMVSSDSTSPDSSLTEESRSETASSL
SQKICNGGLSPGNPGDSKDMKEIEPNYESPSSNNQDKDSSQASKSSIKVPETHKAVLALR
LEEKDGKIAVQTEKEESKASTDVAGQAVTINLVPTEEQAKPYRVVNLEQPLCKPYTVVDV
SAAMASEHLEGPVNSPKTKSSSSTPNSPVTSSSLTPGQISAHFQKSSAIRYQEVWTSSTS
PRQKIPKVELITSGTGPNVPPRKNCHKSAPTSPTATNISSKTIPVKSPNLSEIKFNSYNN
AGMPPFPIIIHDEPTYARSSKNAIKVPIVINPNAYDNLAIYKSFLGTSGELSVKEKTTSV
ISHTYEEIETESKVPDNTTSKTTDCLQTKGFSNSTEHKRGSVAQKVQEFNNCLNRGQSSP
QRSYSSSHSSPAKIQRATQEPVAKIEGTQESQMVGSSSTREKASTVLSQIVASIQPPQSP
PETPQSGPKACSVEELYAIPPDADVAKSTPKSTPVRPKSLFTSQPSGEAEAPQTTDSPTT
KVQKDPSIKPVTPSPSKLVTSPQSEPPAPFPPPRSTSSPYHAGNLLQRHFTNWTKPTSPT
RSTEAESVLHSEGSRRAADAKPKRWISFKSFFRRRKTDEEDDKEKEREKGKLVGLDGTVI
HMLPPPPVQRHHWFTEAKGESSEKPAIVFMYRCDPAQGQLSVDQSKARTDQAAVMEKGRA
ENALLQDSEKKRSHSSPSQIPKKILSHMTHEVTEDFSPRDPRTVVGKQDGRGCTSVTTAL
SLPELEREDGKEDISDPMDPNPCSATYSNLGQSRAAMIPPKQPRQPKGAVDDAIAFGGKT
DQEAPNASQPTPPPLPKKMIIRANTEPISKDLQKSMESSLCVMANPTYDIDPNWDASSAG
SSISYELKGLDIESYDSLERPLRKERPVPSAANSISSLTTLSIKDRFSNSMESLSSRRGP
SCRQGRGIQKPQRQALYRGLENREEVVGKIRSLHTDALKKLAVKCEDLFMAGQKDQLRFG
VDSWSDFRLTSDKPCCEAGDAVYYTASYAKDPLNNYAVKICKSKAKESQQYYHSLAVRQS
LAVHFNIQQDCGHFLAEVPNRLLPWEDPDDPEKDEDDMEETEEDAKGETDGKNPKPCSEA
ASSQKENQGVMSKKQRSHVVVITREVPCLTVADFVRDSLAQHGKSPDLYERQVCLLLLQL
CSGLEHLKPYHVTHCDLRLENLLLVHYQPGGTAQGFGPAEPSPTSSYPTRLIVSNFSQAK
QKSHLVDPEILRDQSRLAPEIITATQYKKCDEFQTGILIYEMLHLPNPFDENPELKEREY
TRADLPRIPFRSPYSRGLQQLASCLLNPNPSERILISDAKGILQCLLWGPREDLFQTFTA
CPSLVQRNTLLQNWLDIKRTLLMIKFAEKSLDREGGISLEDWLCAQYLAFATTDSLSCIV
KILQHR
NT seq 5241 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcttgtaacacctttactgaacatgtttggaaacctggtgaatgcaagaattgc
tttaaacctaaaagtttgcaccagcttcccccagaccctgagaaggcacccatcacccat
ggcaatgtgaaaactaatgccaatcacagtaacaaccaccgcatcaggaacacgggcaat
ttccggcctcctgtggctaaaaaacccactatagctgtgaagcccactatgatagtggca
gatgggcaaagtatatgtggtgagcttagcatccaagaacactgtgagaacaaacctgtc
atcatagggtggaaccgaaacagagctgccttgagtcagaaaccacttaacaataataat
gaagatgatgaaggaattagccatgttcctaagccttatggcaataatgatagtgcaaag
aagatgtcagataacaataatggactaactgaagtgttaaaggagatagcaggcttggat
actgcccctcagataagaggaaatgaaacaaactccagagaaacattcttgggaagaata
aatgattgctataaacgatcattggaaagaaagcttccaccaagttgcatgataggtggg
ataaaggaaactcagggcaagcatgttattctgagtgggagcacagaagtgattagtaat
gaagggggccggttctgttacccagagttttccagtggcgaggagagtgaagaggatgta
cttttcagtaacatggaggaggagcacgagagttgggatgagagtgatgaagagctgttg
gccatggagattcgcatgagagggcaacctcgctttgccaacttcagagcaaacacattg
tctcctgttcgattctttgtggacaaaaaatggaataccatccccctgcgaaacaagtct
ctgcagagaatctgtgctgtggactatgatgacagctatgatgaaatcctgaatggttat
gaggaaaattctgtggtctcttatggacaaggaagcattcagagcatggtgtcatctgac
tccacatcaccagattcttctttaacagaagaatcacgttctgagacagccagtagttta
tcccagaagatttgtaatgggggattatctcctggtaacccaggagattctaaggacatg
aaggaaattgagcccaattatgaaagtccctctagtaataatcaggataaagattcatca
caggcttccaaaagctcaataaaagttccagagacccacaaagcagtccttgctctccga
ttagaagagaaagatggcaagattgctgtacaaactgagaaggaagaaagtaaagcctct
acagatgttgctgggcaagcagtaaccataaaccttgtccccacagaagagcaagcaaaa
ccttaccgagttgtgaacctggaacagccattgtgcaagccatatactgtcgtggatgtg
tcagcagccatggccagtgagcacctcgagggccctgttaacagccccaagacaaaaagc
tcatcctctactccaaactctccagttacatcatcttcattgacaccaggacaaataagt
gcccatttccaaaaatccagtgcaattcgataccaagaagtatggacttctagcaccagt
ccacgacaaaagatacctaaagtagaactaattactagtggaactggaccaaatgttcct
ccaaggaaaaactgtcacaaatcagcacctacatcacccacagctacaaacatttcctcc
aaaaccatccctgttaagtcacctaatttgtctgaaattaaatttaatagttataacaat
gctggtatgccaccttttccaattatcattcatgacgagccaacttatgctcggagttcc
aaaaatgctatcaaagttcccattgttatcaatccaaatgcatatgacaatctagctatc
tacaaaagttttctgggaacaagtggagaactctcagtgaaggaaaaaaccacaagtgta
ataagccatacttatgaagaaatagaaacagaaagcaaagtgcctgataacaccactagc
aaaaccactgactgtcttcaaactaaagggttttcaaacagcacagagcataaaaggggc
tcagtggctcagaaggttcaagagtttaacaactgtctcaacagaggtcagtcttcacca
cagagaagctatagttccagccacagctccccagcaaagatccagagagccactcaagag
cctgtggccaaaatagaaggcactcaggagtctcagatggtgggcagcagcagcaccaga
gagaaagcaagcacagtgctttctcagattgtggcttcaatccaacccccacagtctcct
ccagaaacacctcaatctggccctaaagcttgcagtgtggaagagctttatgccattcct
ccagatgctgatgttgctaagagcacacctaagagtacgccagtccggcccaaatctctc
tttacatctcagcctagtggtgaggctgaagcacctcagaccacagacagtcctaccacc
aaagtacagaaagacccatccataaagccagtcaccccctctccctccaaattagtgact
agcccccaaagtgagccaccagctccctttcccccgccacgctctacttcttctccttac
catgcaggtaaccttttgcagaggcatttcaccaactggaccaagccaaccagccctacc
aggtcaacagaagctgaatcagttttgcactctgaaggcagcaggcgggcagctgatgca
aaacctaagcgctggatatcatttaaaagcttcttccgccgtcggaaaacagatgaggag
gatgacaaagagaaagagcgagagaaagggaaactggtgggcctggatggcacagtcatt
cacatgctgcctcctcctccagttcagcgccatcactggttcacagaggcgaaaggagag
tccagtgagaaaccagccattgtcttcatgtacaggtgcgaccctgctcaaggccagctc
agtgtggatcagagcaaggctaggacagaccaggcagcagtcatggagaagggtagagca
gagaatgcattactacaggactcagagaagaagaggagtcattcttctccatcacagatt
cctaaaaagattctcagtcacatgacccatgaagtaacagaggatttttctcctcgggat
ccaagaactgttgttgggaagcaagatggcaggggctgcacttcagtcacaacagcattg
tccctacctgaactggaaagggaagatggaaaagaagacatttcagatcctatggacccg
aacccttgtagtgcaacatacagcaacttagggcaatctagagcagccatgatacctccc
aagcagccacgacagcccaagggagctgtggacgatgccatcgcctttggagggaaaaca
gaccaagaagcacccaatgcttcccaacctacaccacccccactgccaaagaagatgatc
ataagagccaatacagagccaatctccaaggacctccaaaaatccatggaaagtagtctt
tgtgtcatggctaatcccacctatgatatcgaccccaactgggatgccagcagtgctggt
tcttccatcagctatgaactcaaaggactggacattgagtcttatgactccttggaaagg
cctttgcgcaaggagagacctgtcccctcagcagcaaacagcatttccagcttaaccact
ctcagtattaaggatagattttccaacagcatggaatccctctccagccggcgtgggccc
tcttgcagacagggccgaggcatccagaagccgcagagacaagcactttatcgaggactt
gagaatcgggaggaagtagtgggtaaaatccgaagccttcatacagatgccttgaagaaa
ctggctgttaaatgcgaagaccttttcatggctgggcagaaagaccagctccgttttgga
gtggacagctggtcagacttcaggctaaccagtgacaaaccatgttgtgaggcaggtgat
gcggtttactatactgcttcatatgcaaaagatccacttaataactatgcagtcaagatc
tgtaagagcaaagctaaagaatctcagcagtattatcacagcttggctgtccggcagagt
ctggctgtccattttaacattcagcaggactgtggtcatttccttgctgaagtccctaac
cgtctgcttccctgggaggatccagatgaccctgaaaaggatgaggatgacatggaagag
actgaagaagacgccaaaggagaaacggatgggaaaaacccaaagccctgttctgaagca
gcatcatcccagaaagagaatcagggagtcatgagcaagaagcagaggagccacgttgtg
gtcatcaccagggaggttccatgtcttactgtggctgattttgtgcgagactctctggcc
cagcatgggaaaagccctgatttgtatgagaggcaggtgtgtctgctgctcttacagcta
tgctctggtcttgagcacctcaaaccctaccatgtcactcactgcgatctacgcctagag
aacctgctacttgtccactaccagcctggggggactgcccaaggctttgggcctgcagag
cccagccccacctcatcttatcccactaggcttatagtgagcaacttctctcaggccaag
cagaagagccatctggtggaccccgagatcctccgggaccagtctcgccttgccccagag
atcataacagctacccagtataaaaagtgtgatgagttccagacaggcatcctcatctat
gagatgctgcacctacccaacccctttgatgagaacccagagctgaaggagagggaatac
acacgagcagacctgcctcgcatcccattccgctccccctactcccggggtctgcagcag
ctggccagctgcctcctgaatcccaacccttctgagcggatcctcatttcagacgccaaa
ggcatcctccagtgtctgctctggggcccccgcgaagatctcttccagactttcaccgcc
tgccctagcctagtacagaggaacaccctgctccaaaactggctagacatcaagcgaaca
ctgctcatgatcaagtttgctgagaagtccctggacagggaaggtggaatcagccttgag
gactggctttgtgctcagtatttggcttttgccactacagactccctcagttgtattgtg
aaaattctgcagcaccgttaa

DBGET integrated database retrieval system