KEGG   Homo sapiens (human): 79837Help
Entry
79837             CDS       T01001                                 

Gene name
PIP4K2C, PIP5K2C
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase type 2 gamma
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    79837 (PIP4K2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    79837 (PIP4K2C)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    79837 (PIP4K2C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     79837 (PIP4K2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K
Motif
Other DBs
NCBI-GeneID: 79837
NCBI-ProteinID: NP_001139730
OMIM: 617104
HGNC: 23786
Ensembl: ENSG00000166908
Vega: OTTHUMG00000170144
Pharos: Q8TBX8(Tbio)
UniProt: Q8TBX8 B3KQV3
Structure
PDB: 

Position
12q13.3
AA seq 421 aa AA seqDB search
MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEA
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcctcggtcccaccagccacggtatcggcggcgacagcaggccccggccca
ggtttcggcttcgcctccaagaccaagaagaagcatttcgtgcagcagaaggtgaaggtg
ttccgggcggccgacccgctggtgggtgtgttcctgtggggcgtagcccactcgatcaat
gagctcagccaggtgcctcccccggtgatgctgctgccagatgactttaaggccagctcc
aagatcaaggtcaacaatcaccttttccacagggaaaatctgcccagtcatttcaagttc
aaggagtattgtccccaggtcttcaggaacctccgtgatcgatttggcattgatgaccaa
gattacttggtgtcccttacccgaaacccccccagcgaaagtgaaggcagtgatggtcgc
ttccttatctcctacgatcggactctggtcatcaaagaagtatccagtgaggacattgct
gacatgcatagcaacctctccaactatcaccagtacattgtgaagtgccatggcaacacg
cttctgccccagttcctggggatgtaccgagtcagtgtggacaacgaagacagctacatg
cttgtgatgcgcaatatgtttagccaccgtcttcctgtgcacaggaagtatgacctcaag
ggttccctagtgtcccgggaagccagcgataaggaaaaggttaaagaattgcccaccctt
aaggatatggactttctcaacaagaaccagaaagtatatattggtgaagaggagaagaaa
atatttctggagaagctgaagagagatgtggagtttctagtgcagctgaagatcatggac
tacagccttctgctaggcatccacgacatcattcggggctctgaaccagaggaggaagcg
cccgtgcgggaggatgagtcagaggtggatggggactgcagcctgactggacctcctgct
ctggtgggctcctatggcacctccccagagggtatcggaggctacatccattcccatcgg
cccctgggcccaggagagtttgagtccttcattgatgtctatgccatccggagtgctgaa
ggagccccccagaaggaggtctacttcatgggcctcattgatatccttacacagtatgat
gctaagaagaaagcagctcatgcagccaaaactgtcaagcatggggctggggcagagatc
tctactgtccatccggagcagtatgctaagcgattcctggattttattaccaacatcttt
gcctaa

DBGET integrated database retrieval system