KEGG   Homo sapiens (human): 7984
Entry
7984              CDS       T01001                                 

Gene name
ARHGEF5, GEF5, P60, TIM, TIM1
Definition
(RefSeq) Rho guanine nucleotide exchange factor 5
  KO
K20684  Rho guanine nucleotide exchange factor 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7984 (ARHGEF5)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    7984 (ARHGEF5)
SSDB
Motif
Pfam: ARHGEF5_35 RhoGEF SH3_9 SH3_1 SH3_2 PH
Other DBs
NCBI-GeneID: 7984
NCBI-ProteinID: NP_005426
OMIM: 600888
HGNC: 13209
Ensembl: ENSG00000050327
Vega: OTTHUMG00000158004
Pharos: Q12774(Tbio)
UniProt: Q12774
Position
7q35
AA seq 1597 aa
MEAEEAQRGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQ
QSELRDVCDYAIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLA
PPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQT
RYYSPCEEHPAETNQNEGSESGTIRQGEELPPEELQESQGLLHPQEVQVLEEQGQQEAGF
RGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGL
NDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQTFLGKSEEVTGKQE
DHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCD
LFPGASYLMTQIPGTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFLTEESPDKEID
QNSQQEESRLRKGTVSSQGTEVVFASASVTPPRTPDSAPPSPAEAYPITPASVSARPPVA
FPRRETSCAARAPETASAPLSMDDPSPCGTSEMCPAALYGFPSTGTSPPRPPANSTGTVQ
HLRSDSFPGSHRTEQTPDLVGMLLSYSHSELPQRPPKPAIYSSVTPRRDRRSGRDYSTVS
ASPTALSTLKQDSQESISNLERPSSPPSIQPWVSPHNPAFATESPAYGSSPSFVSMEDVR
IHEPLPPPPPQRRDTHPSVVETDGHARVVVPTLKQHSHPPPLALGSGLHAPHKGPLPQAS
DPAVARQHRPLPSTPDSSHHAQATPRWRYNKPLPPTPDLPQPHLPPISAPGSSRIYRPLP
PLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPACQDWTVPLPASAGRTSWPP
ATARSTESFTSTSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGPTSKDEAGVSEHP
EAPAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSG
QAVAPSEGANKHKGWSRQGLRRPSILPEGSSDSRGPAVEKHPGPSDTVVFREKKPKEVMG
GFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPRQPRKALVSSESY
LQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHF
QLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAPDF
RRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRL
KLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFECK
IFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVF
DHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQAEFLFRTETQSEKLRWISALAMP
REELDLLECYNSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGW
FPVQQVEFISNPEVRAQNLKEAHRVKTAKLQLVEQQA
NT seq 4794 nt   +upstreamnt  +downstreamnt
atggaggctgaggaggcccagcgtggagcctctcctcccatctctgccatagaggaattc
agcattatccctgaggctcccatgaggagcagccaggtctctgccttggggcttgaagct
caagaagatgaggacccatcctataagtggagagaggaacacagactctcagcaactcag
cagagtgagttaagggatgtgtgtgactatgcgattgagacgatgccctcttttcccaag
gaaggttctgcagatgtggagcccaatcaggaaagccttgtggctgaggcctgtgacact
ccggaacactgggaggcagtaccccagagcctagcaggccgacaagcaaggactctagct
cccccagagctctgggcctgccccattcagagtgagcatctagacatggccccattttcc
agtgacctgggaagcgaagaagaggaggtggaattttggccaggacttacttctttgaca
ttgggatctggacaggcagaagaagaagaggaaacctcttcagataactctggtcagacc
agatattattctccctgcgaagagcatcctgcagagaccaaccagaatgaaggctctgaa
agtgggactatcaggcagggggaagagctgccacctgaggagctgcaggaaagtcaaggg
ctcttgcatccccaggaggtccaagttctggaggagcagggacagcaggaagcaggattt
cggggggaaggaactctgagggaggatgtttgtgccgatgggctattaggggaggaacag
atgatagagcaggttaatgatgaaaagggagaacagaagcaaaaacaggaacaggtacaa
gatgtgatgcttgggagacaaggagaaagaatggggctcactggggagccagagggtctg
aatgacggtgagtgggagcaggaggatatggagaggaaggctcagggtcagggaggtcca
gaacagggagaagagaggaagagggagctgcaggtgccagaagagaatagggcggactct
caggacgaaaagagtcaaacctttttgggaaaatcagaggaagtaactggaaagcaagaa
gatcatggtataaaggagaaaggggtgccagtcagcgggcaggaggcgaaagagccagag
agttgggatgggggcaggctgggggcagtgggaagagcgaggagcagggaagaggagaat
gagcatcatgggccttcaatgcccgctctgatagcccctgaggactctcctcactgtgac
ctgtttccaggtgcctcatatctcatgactcagattcccgggactcagacagagtccagg
gctgaggaactgtcccccgcagctctgtctccctcgctagagcccatcaggtgctctcac
cagcccatttctctactgggctcctttttgactgaggagtcacctgacaaggaaatagat
caaaacagccagcaagaggaatccaggctgaggaagggaacagtgtccagccaagggact
gaggtggtctttgccagtgcatctgtgactcctccaaggacaccagattcagctcctccc
agtcctgctgaagcctaccccatcacacctgcctcggtatctgccaggcccccagttgcc
tttcccaggagggaaacctcttgtgctgcacgtgctccagaaactgccagtgcccctctc
tcaatggatgacccatctccctgtgggacttctgagatgtgcccggctgccctctatggc
ttcccctccaccgggaccagccctccgaggcccccagccaactccacaggcaccgtccag
cacttacggagtgactccttccctggttctcacaggacagagcagactccagacctggtg
ggaatgttgctttcctactcccactcagagctgccccagaggccccccaaacctgccatc
tacagctctgtgaccccaagaagggacagaaggagtggtagggactacagcaccgtttca
gcatcccctactgccttatccacgctgaagcaggactctcaagaatccatctcaaatcta
gagagacccagcagtcctcccagcatccagccctgggtctccccacataatccagccttt
gccacagagtctcccgcctacggttcttccccatcctttgtctccatggaggatgtgagg
atccacgaacctctgccccctcctcccccacagaggagggacacccatccctccgtggtg
gagacagatggccatgctcgtgtagtggttcccacgctgaagcagcatagccaccctcct
ccattggccctaggttcagggctgcatgccccccataaaggcccacttccccaagcctct
gaccccgctgtggccaggcagcaccgacctctgccatctaccccagacagctcccaccat
gctcaggccacccccaggtggagatacaacaagccgctaccccctacccctgatttgccg
cagccccaccttcctcccatttctgctcctggtagctcaaggatctacaggcctctaccc
ccactacccatcatagaccctcccaccgaaccacccccattgcccccaaagtccaggggg
aggagcaggagcactcggggaggacatatgaactcagggggtcatgccaaaacaagacct
gcttgtcaagactggacagtccccctccctgcctctgctggacgcacctcctggcccccg
gccacagctagatcaacagagtctttcacttccaccagcaggagtaagagcgaagtgtcc
cctggcatggctttcagcaacatgacaaacttcctatgcccctcttcccctaccactccc
tggactccggagctccagggacccacctctaaggatgaagcaggggtctcagaacaccct
gaggcccctgcgagagaacctttgagaaggacaacccctcagcaaggagccagtggccca
gggaggtcacctgtgggccaagcaaggcagccagaaaaacccagccatctgcacctggag
aaggcgtccagctggccccacaggcgggactcagggaggccaccaggggacagcagtgga
caggctgtggctcctagtgagggggccaacaagcacaagggctggagccggcagggcctg
cgcagaccttccatcttgcctgagggctcttcagattcaagaggtccagccgtggagaaa
catccgggaccctcagacactgttgtttttcgggagaaaaaaccaaaggaggtgatggga
ggcttttcaagacgctgctccaaactcatcaactcctcccagctgctttaccaggagtat
agtgatgttgtcctgaataaggagatccagagccagcagcggctggagagcctgtccgag
acacccgggcctagctctccgcggcagcctcggaaggccctggtctcctccgagtcgtac
ctgcagcggctctccatggcctccagcggctccctctggcaggaaatccccgtggtgcgc
aacagcaccgtgctgctctccatgacccatgaagaccaaaagctgcaagaggtcaaattt
gagctgattgtgtcagaggcctcctacctgcgcagtctaaacatagctgtggatcatttc
caactttcaacttcactccgggccacactttccaaccaggagcaccaatggctcttctct
cgtttacaggatgtgcgagacgtcagcgccacgttcctttcagacctggaagagaacttt
gagaacaatatcttctccttccaagtatgtgacgtagtcctgaaccacgccccagacttc
cgccgggtctacctgccttatgtcaccaaccagacctatcaggaacgcaccttccagagc
ctgatgaatagcaacagcaatttccgggaggtcttggagaagctggagagcgaccccgtc
tgccagcgcctttccctcaagtcctttctgattctgcccttccaacgcatcacccgcctc
aaactgctgctccagaacattctgaagagaacacagcctggctcctcggaggaggcagag
gccacgaaggcacaccacgccctggagcagctgatccgggactgcaataacaatgtccag
agtatgcgacggacagaggaactaatctacctgagccagaagattgagtttgagtgcaaa
atattcccgctcatttctcagtcacgctggctggtgaaaagtggggagctgacagccttg
gagttcagtgcttccccagggctacgaaggaagctgaacacgcgtccagtccacctgcac
ctcttcaatgactgtctgctgctgtctcggccccgagagggtagccgattcctggtattt
gaccatgctcccttctcctccattcggggggaaaagtgtgaaatgaagctacatggacct
cacaaaaacctgttccgactctttctgcggcagaacactcagggcgcccaggccgagttc
ctcttccgcacggagactcaaagtgaaaagcttcggtggatctcagccttggccatgcca
agagaggagttggaccttctggagtgttacaactccccccaggtacagtgccttcgagcc
tacaagccccgagagaatgatgaattggcactggagaaagccgacgtggtgatggtgact
cagcagagcagtgacggctggctggagggcgtgaggctctcagacggggagcgaggctgg
tttcctgtgcagcaggtggagttcatttccaacccagaggtccgtgcacagaacctgaag
gaagctcatcgagtcaagactgccaaactacagctggtggaacagcaagcctaa

DBGET integrated database retrieval system