KEGG   Homo sapiens (human): 79847Help
Entry
79847             CDS       T01001                                 

Gene name
MFSD13A, C10orf77, TMEM180, bA18I14.8
Definition
(RefSeq) major facilitator superfamily domain containing 13A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_2
Motif
Other DBs
NCBI-GeneID: 79847
NCBI-ProteinID: NP_079065
HGNC: 26196
Ensembl: ENSG00000138111
Vega: OTTHUMG00000018961
Pharos: Q14CX5(Tdark)
UniProt: Q14CX5
Position
10q24.32
AA seq 517 aa AA seqDB search
MGLGQPQAWLLGLPTAVVYGSLALFTTILHNVFLLYYVDTFVSVYKINKMAFWVGETVFL
LWNSLNDPLFGWLSDRQFLSSQPRSGAGLSSRAVVLARVQALGWHGPLLALSFLAFWVPW
APAGLQFLLCLCLYDGFLTLVDLHHHALLADLALSAHDRTHLNFYCSLFSAAGSLSVFAS
YAFWNKEDFSSFRAFCVTLAVSSGLGFLGATQLLRRRVEAARKDPGCSGLVVDSGLCGEE
LLVGSEEADSITLGRYLRQLARHRNFLWFVSMDLVQVFHCHFNSNFFPLFLEHLLSDHIS
LSTGSILLGLSYVAPHLNNLYFLSLCRRWGVYAVVRGLFLLKLGLSLLMLLAGPDHLSLL
CLFIASNRVFTEGTCKLLTLVVTDLVDEDLVLNHRKQAASALLFGMVALVTKPGQTFAPL
LGTWLLCFYTGHDLFQQSLITPVGSAHPWPEPPAPAPAQAPTLRQGCFYLLVLVPITCAL
LQLFTWSQFTLHGRRLHMVKAQRQNLSQAQTLDVKMV
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggtcagccccaggcctggttgctgggtctgcccacagctgtggtctatggc
tccctggctctcttcaccaccatcctgcacaatgtcttcctgctctactatgtggacacc
tttgtctcagtgtacaagatcaacaaaatggccttctgggtcggagagacagtgtttctc
ctctggaacagcctcaatgaccccctcttcggttggctcagtgaccggcagttcctcagc
tcccagccccggtcaggcgccgggctctcctcaagggctgtggtgctggcccgggtgcag
gccctgggctggcatgggccgctgctggcgctgtcgttcctggcgttctgggtgccctgg
gccccagctggcctgcagttcttgctgtgcctgtgcctctatgatggcttcctgacgctc
gtggacctgcaccaccatgccttgctggccgacctggccctctcagcccacgaccgcacc
cacctcaacttctactgctccctcttcagcgcggccggctccctctctgtctttgcatcc
tatgccttttggaacaaggaggatttctcctccttccgcgctttctgcgtgacactggct
gtcagctctgggctgggctttctgggggccacacagctgctgaggcggcgggttgaggcg
gcccgaaaggacccagggtgctcaggcctggttgtggatagcggcctgtgtggagaggag
ctgcttgtaggcagtgaggaggcggacagcatcaccttgggccggtatctccggcagctg
gcacgccatcggaacttcctgtggttcgtgagcatggacctggtgcaggtcttccactgc
cacttcaacagcaacttcttccctctcttcctggagcatctgttgtccgaccatatctcc
ctttccacgggctccatcctgttgggcctctcctatgtcgctccccatctcaacaacctc
tacttcctgtccctgtgccggcgctggggcgtctacgcggtggtgcgggggctcttcctg
ctcaagctgggacttagcctgctcatgttgttggccggcccggaccacctcagcctgctg
tgcctcttcattgccagcaaccgcgtcttcactgagggcacctgtaagctgctgaccttg
gtggtcactgacctggtagacgaggacctggtgctgaaccaccgcaagcaggcagcctcg
gcactcctctttggcatggttgccttggtgaccaagccaggccagacctttgccccgctg
ctgggcacctggctgctctgtttctacacaggtcatgacctcttccagcagtccctcata
acccctgtggggagtgcccatccctggccagagcccccagctccagcccctgcacaggcc
ccgacgctccgccagggctgcttctacctgctggtgctggtgcccatcacctgtgctctg
ctgcagctcttcacctggtcccagttcacgctgcatgggagacgcctgcacatggtcaag
gcccagcgccagaacctgtcacaggcccaaaccctggatgttaagatggtgtga

DBGET integrated database retrieval system