KEGG   Homo sapiens (human): 79850
Entry
79850             CDS       T01001                                 
Symbol
TLCD3A, CT120, FAM57A
Name
(RefSeq) TLC domain containing 3A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: TRAM_LAG1_CLN8
Other DBs
NCBI-GeneID: 79850
NCBI-ProteinID: NP_079068
OMIM: 611627
HGNC: 29646
Ensembl: ENSG00000167695
Pharos: Q8TBR7(Tdark)
UniProt: Q8TBR7
Position
17:732596..742968
AA seq 257 aa
MLLTLAGGALFFPGLFALCTWALRRSQPGWSRTDCVMISTRLVSSVHAVLATGSGIVIIR
SCDDVITGRHWLAREYVWFLIPYMIYDSYAMYLCEWCRTRDQNRAPSLTLRNFLSRNRLM
ITHHAVILFVLVPVAQRLRGDLGDFFVGCIFTAELSTPFVSLGRVLIQLKQQHTLLYKVN
GILTLATFLSCRILLFPFMYWSYGRQQGLSLLQVPFSIPFYCNVANAFLVAPQIYWFCLL
CRKAVRLFDTPQAKKDG
NT seq 774 nt   +upstreamnt  +downstreamnt
atgctgctgacgctggccgggggcgcgctcttcttcccggggctcttcgcgctctgcacc
tgggcgctgcgccgctcccagcccggatggagccgcaccgactgcgtgatgatcagcacc
aggctggtttcctcggtgcacgccgtgctggccaccggctcggggatcgtcatcattcgc
tcctgcgacgacgtgatcaccggcaggcactggcttgcccgggaatatgtgtggtttctg
attccatacatgatctatgactcgtacgccatgtacctctgtgaatggtgccgaaccaga
gaccagaaccgtgcgccctccctcactcttcgaaacttcctaagtcgaaaccgcctcatg
atcacacatcatgcggtcattctctttgtccttgtgccagtcgcacagaggctccgggga
gaccttggggacttctttgtcggctgcatcttcacggcagaactgagcactccgtttgtg
tcgctgggcagggttctgattcagctaaagcagcagcacacccttctgtacaaggtgaat
ggaatcctcacgctggccaccttcctttcctgccggatccttctcttccccttcatgtac
tggtcctatggccgccagcagggactaagcctgctccaagtacccttcagcatcccattc
tactgcaacgtggccaatgccttcctcgtagctcctcagatctactggttctgtctgctg
tgcaggaaggcagtccggctctttgacactccccaagccaaaaaggatggctaa

DBGET integrated database retrieval system