KEGG   Homo sapiens (human): 79856
Entry
79856             CDS       T01001                                 

Gene name
SNX22
Definition
(RefSeq) sorting nexin 22
  KO
K17941  sorting nexin-22/24
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    79856 (SNX22)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   79856 (SNX22)
SSDB
Motif
Pfam: PX DUF4183
Other DBs
NCBI-GeneID: 79856
NCBI-ProteinID: NP_079074
HGNC: 16315
Ensembl: ENSG00000157734
Vega: OTTHUMG00000132965
Pharos: Q96L94(Tdark)
UniProt: Q96L94 A0A024R5Y5
Structure
PDB: 
2ETT

Position
15q22.31
AA seq 193 aa
MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKV
PDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWG
TLREFLPGDSSSQQHQRPVLSFHVDPYVCNPSPESLPNVVVNGVLQGLYSFSISPDKAQP
KAACHPAPLPPMP
NT seq 582 nt   +upstreamnt  +downstreamnt
atgctggaagttcacatcccgtcggtggggcccgaggccgaggggcccaggcagagcccg
gagaaaagccacatggtgttccgagtggaggtgctgtgcagcgggcgcagacacacggtg
ccaaggcgctacagcgagttccacgcgctgcacaagcggatcaagaagctgtacaaagtg
cccgacttcccctcgaaacgcctgcccaactggaggaccagagggttggaacagcgccgg
cagggcttggaggcttacatccagggcatcctgtacctgaaccaggaggtgcccaaggag
ttactggaattcctgagacttcggcacttccccacagaccccaaggctagcaactggggc
accctgagggagttcctgcctggcgacagcagctcccagcagcaccagcggcctgtcctg
agcttccatgtggatccctatgtttgcaacccctccccagagtcgctgcccaacgtggtg
gtgaatggtgtgctccagggcctctacagcttcagcatcagcccagataaagcccagcca
aaggcggcctgtcaccctgctcctctgccaccgatgccctga

DBGET integrated database retrieval system