KEGG   Homo sapiens (human): 79858
Entry
79858             CDS       T01001                                 
Symbol
NEK11
Name
(RefSeq) NIMA related kinase 11
  KO
K20880  serine/threonine-protein kinase Nek11 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    79858 (NEK11)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    79858 (NEK11)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     79858 (NEK11)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NEK family
   79858 (NEK11)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    79858 (NEK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Rtt106_N
Other DBs
NCBI-GeneID: 79858
NCBI-ProteinID: NP_001308149
OMIM: 609779
HGNC: 18593
Ensembl: ENSG00000114670
Pharos: Q8NG66(Tbio)
UniProt: Q8NG66 B4DM56
Position
3:131026877..131350465
AA seq 645 aa
MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVL
KEISVGELNPNETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKI
QEYKQAGKIFPENQIIEWFIQLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSR
LLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEMCCMNHAFAGSNFLSI
VLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSE
MTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKL
KKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE
ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYA
DAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSL
DTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNAS
EAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgctgaaattccaagaggcagctaagtgtgtgagtggatcaacagccatttccacttat
ccaaagaccttgattgcaagaagatacgtgcttcaacaaaaacttggcagtggaagtttt
ggaactgtctatctggtttcagacaagaaagccaaacgaggagaggaattaaaggtactt
aaggaaatatctgttggagaactaaatccaaatgaaactgtacaggccaatttggaagcc
caactcctctccaagctggaccacccagccattgtcaagttccatgcaagttttgtggag
caagataatttctgcattatcacggagtactgtgagggccgagatctggacgataaaatt
caggaatataaacaagctggaaaaatctttccagaaaatcaaataatagaatggtttatc
cagctgctgctgggagttgactacatgcatgagaggaggatacttcatcgagacttaaag
tcaaagaatgtatttctgaaaaataatctccttaaaattggagattttggagtttctcga
cttctaatgggatcctgtgacctggccacaactttaactggaactccccattatatgagt
cctgaggctctgaaacaccaaggctatgacacaaagtcggacatctggtcactggcatgc
attttgtatgagatgtgctgcatgaatcatgcattcgctggctccaatttcttatccatt
gttttaaaaattgttgaaggtgacacaccttctctccctgagagatatccaaaagaacta
aatgccatcatggaaagcatgttgaacaagaatccttcattaagaccatctgctatcgaa
attttaaaaatcccttaccttgatgagcagctacagaacctaatgtgtagatattcagaa
atgactctggaagacaaaaatttggattgtcagaaggaggctgctcatataattaatgcc
atgcaaaaaaggatccacctgcagactctgagggcactgtcagaagtacagaaaatgacg
ccaagagaaaggatgcggctgaggaagctccaggcggctgatgagaaagccaggaagctg
aaaaagattgtggaagaaaaatatgaagaaaatagcaaacgaatgcaagaattgagatct
cggaactttcagcagctgagtgttgatgtactccatgaaaaaacacatttaaaaggaatg
gaagaaaaggaggagcaacctgagggaagactttcttgttcaccccaggacgaggatgaa
gagaggtggcaaggcagggaagaggaatctgatgaaccaactttagagaacctgcctgag
tctcagcctattccttccatggacctccacgaacttgaatcaattgtagaggatgccaca
tctgaccttggataccatgagatcccagaagacccacttgtggctgaagagtactacgct
gatgcatttgattcctattgtgaagagagtgatgaggaggaagaagaaatagcgttagaa
agaccagagaaagaaatcaggaatgagggatcccagcctgcttacagaacaaaccaacag
gacagtgatatcgaagcgttggccaggtgtttggaaaatgtcctgggttgcacttctcta
gacacaaagaccatcaccaccatggctgaagacatgtccccaggaccaccaattttcaac
agtgtgatggccaggaccaagatgaaacgcatgagggaatcagccatgcagaagctgggg
acagaagtatttgaagaggtctataattacctcaagagagcaaggcatcagaatgctagc
gaagcagagatccgcgagtgtttggaaaaagtggtgcctcaagccagcgactgttttgaa
gtggaccagctcctgtactttgaagagcagttgctgatcacgatgggaaaagaacctact
ctccagaaccatctctag

DBGET integrated database retrieval system