KEGG   Homo sapiens (human): 79866
Entry
79866             CDS       T01001                                 

Gene name
BORA, C13orf34
Definition
(RefSeq) BORA aurora kinase A activator
  KO
K16831  protein aurora borealis
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79866 (BORA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     79866 (BORA)
SSDB
Motif
Pfam: BORA_N
Other DBs
NCBI-GeneID: 79866
NCBI-ProteinID: NP_001273675
OMIM: 610510
HGNC: 24724
Ensembl: ENSG00000136122
Vega: OTTHUMG00000017068
Pharos: Q6PGQ7(Tbio)
UniProt: Q6PGQ7 A0A087WV86
Position
13q21.33
AA seq 559 aa
MGDVKESKMQITPETPGRIPVLNPFESPSDYSNLHEQTLASPSVFKSTKLPTPGKFRWSI
DQLAVINPVEIDPEDIHRQALYLSHSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHEGK
QLSQCHSSKCTNINSDSPVGKKLTIHSEKSDAACQTLLSLPVDFNLENILGDYFRADEFA
DQSPGNLSSSSLRRKLFLDGNGSISDSLPSASPGSPHSGVQTSLEMFYSIDLSPVKCRSP
LQTPSSGQFSSSPIQASAKKYSLGSITSPSPISSPTFSPIEFQIGETPLSEQRKFTVHSP
DASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSGGTQYRTSVIQIPFTLETQGE
DEEDKENIPSTDVSSPAMDAAGIHLRQFSNEASTHGTHLVVTAMSVTQNQSSASEKELAL
LQDVEREKDNNTVDMVDPIEIADETTWIKEPVDNGSLPMTDFVSGIAFSIENSHMCMSPL
AESSVIPCESSNIQMDSGYNTQNCGSNIMDTVGAESYCKESDAQTCEVESKSQAFNMKQD
HTTQRCWMKTASPFQCSSP
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgggagatgtcaaggaatcaaagatgcaaataacaccagaaactccaggaaggatccct
gttttaaatccttttgaaagtcctagtgattattctaatctccatgaacaaactctcgcc
agtccttctgtttttaaatcaacaaaattaccaactccagggaaatttagatggtctatt
gatcaactagctgtaataaatcctgtagaaatagacccagaagatattcatcgtcaagct
ttatacttaagtcattctcgaatagataaagatgtggaagacaaaagacaaaaagccatt
gaagagtttttcactaaagatgtcatcgtaccctctccttggactgatcatgaagggaaa
cagctttcacaatgtcattccagtaaatgcactaacataaatagtgactctccagttgga
aaaaagctgaccattcattctgagaaaagcgatgctgcttgtcagacattgctgtctctt
cctgtggattttaatttagaaaatatattaggtgactattttagagctgatgaatttgca
gatcaatctcctggaaacctcagttcttcatccctcagaagaaagctgtttttagatggg
aacggaagcatctccgactccttaccttcggcttctcccggaagtcctcacagtggtgtt
caaacatcactagagatgttttattcaatagatttgtctcctgtaaagtgtaggagcccc
ttgcagacaccaagttcggggcagttttcttctagccctattcaggctagtgcaaaaaaa
tacagcttgggaagcataactagtccttcgcctatttcttcacccactttctcaccaatt
gaatttcagataggagagactccactctcagaacaaaggaagtttactgttcattctcct
gatgcttcatctggaacaaattctaatgggataactaatccgtgtatcagaagtccttat
atagatggctgctcgccaattaaaaattggtctcctatgagacttcagatgtatagtggt
ggtactcagtatcggacctcagtgattcagataccttttactcttgagactcaaggtgaa
gatgaggaagataaagagaatattccttccacagatgtctcatcacccgccatggatgct
gctggaatacacctacggcagtttagtaatgaggcttctacccatggtacacatttggtt
gtgactgccatgtctgttacacaaaatcagtccagtgcttctgagaaagaattagcactg
ttgcaggatgttgaaagggagaaagacaataacactgtggatatggttgatcctatagag
atagcagatgagaccacttggattaaggagccggttgataatggcagtttacccatgact
gattttgtaagtggcattgccttcagtattgaaaactctcatatgtgcatgtcacctctt
gctgaaagcagtgtcattccttgtgaaagcagtaacattcagatggatagtggctataat
acgcagaattgtggaagcaatattatggatacagttggggcagaaagttactgcaaagaa
agtgatgcacaaacatgtgaagttgagagtaaatctcaagcatttaatatgaagcaagac
cacacaacacagaggtgttggatgaaaacagcaagcccttttcaatgcagcagtccatag

DBGET integrated database retrieval system