KEGG   Homo sapiens (human): 79869
Entry
79869             CDS       T01001                                 
Symbol
CPSF7, CFIm59
Name
(RefSeq) cleavage and polyadenylation specific factor 7
  KO
K14398  cleavage and polyadenylation specificity factor subunit 6/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa03250  Viral life cycle - HIV-1
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    79869 (CPSF7)
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    79869 (CPSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    79869 (CPSF7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     79869 (CPSF7)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 79869
NCBI-ProteinID: NP_001129512
HGNC: 30098
Ensembl: ENSG00000149532
Pharos: Q8N684(Tdark)
UniProt: Q8N684
Structure
Position
11:complement(61402729..61429975)
AA seq 471 aa
MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPS
PKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRECVRV
PRGGIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPP
PIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
ATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSSAISKAVSGAS
AGDYSDAIETLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKR
HRSRERSPSRSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgtcagaaggagtggacttgattgatatatatgctgacgaggagttcaaccaggaccca
gagttcaacaatacagatcagattgacctgtatgatgatgtgctgacagccacctcacag
ccctcagatgacagaagcagcagcactgaaccacctcctcctgttcgccaggagccatct
cccaagcccaacaacaagacccctgcaattctgtatacctacagtggcctgcgtaataga
cgagctgccgtttatgtgggcagcttctcctggtggaccacagaccagcagctgatccag
gttattcgctctataggagtctatgatgtggtggagttgaaatttgcagagaatcgagca
aatggccagtccaaagggtatgctgaggtggtggtagcctctgaaaactctgtccacaaa
ttgttggaactcctaccagggaaagttcttaatggagaaaaagtggacgtgaggccggcc
acccggcagaacctgtcacagtttgaggcacaggctcggaaacgtgagtgtgtccgagtc
ccaagagggggaatacctccacgggcccattcccgagattctagtgattctgctgatgga
cgggccacaccctctgagaaccttgtaccctcatctgctcgtgtggataagccccccagt
gtgctgccctacttcaatcgtcctccttcggcccttcccctgatgggtctgcccccacca
ccaattccacccccaccacctctctcctcaagctttggggtccctcctcctcctcctggt
atccactaccagcatctcatgcccccacctcctcgattacctcctcatcttgctgtacct
ccccctggggccatcccacctgcccttcacctcaatccagccttcttccccccaccaaac
gctacagtggggcctccaccagatacttacatgaaggcctctgccccctataaccaccat
ggcagccgagattcgggccctccaccctctacagtgagtgaagccgaatttgaagatatc
atgaagcgaaacagagcaatttccagcagtgccatttccaaagcagtatctggagccagt
gcaggggattacagtgacgcaattgagacgctgctcacagccattgcggttatcaaacag
tcccgggttgccaatgatgagcgttgccgtgtcctcatctcctctcttaaggactgtctt
catggcatcgaagccaagtcctacagtgtgggtgccagtgggagctcttccaggaaaaga
catcgctcccgggaaaggtcacctagccggtcccgggagagcagcaggaggcaccgggat
ctgcttcataatgaagatcggcatgatgattatttccaagaaaggaaccgggagcatgag
agacaccgggatagagaacgggaccggcaccactga

DBGET integrated database retrieval system