KEGG   Homo sapiens (human): 79872
Entry
79872             CDS       T01001                                 

Gene name
CBLL1, HAKAI, RNF188
Definition
(RefSeq) Cbl proto-oncogene like 1
  KO
K15685  E3 ubiquitin-protein ligase Hakai [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    79872 (CBLL1)
   04131 Membrane trafficking [BR:hsa04131]
    79872 (CBLL1)
   04121 Ubiquitin system [BR:hsa04121]
    79872 (CBLL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     79872 (CBLL1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     79872 (CBLL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    79872 (CBLL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    79872 (CBLL1)
SSDB
Motif
Pfam: zf_Hakai zf-C3HC4_3 zf-C3HC4 zf-RING_5 zf-C3HC4_2 zf-RING_UBOX zinc-ribbons_6 zf-RING_4 DZR zf-RING_2 C1_4 zf-MIZ
Other DBs
NCBI-GeneID: 79872
NCBI-ProteinID: NP_079090
OMIM: 606872
HGNC: 21225
Ensembl: ENSG00000105879
Vega: OTTHUMG00000154809
Pharos: Q75N03(Tbio)
UniProt: Q75N03
Position
7q22.3
AA seq 491 aa
MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINRMPAKAPPGDE
EGFDYNEEERYDCKGGELFANQRRFPGHLFWDFQINILGEKDDTPVHFCDKCGLPIKIYG
RMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSIVQGCKRTYLSQR
DLQAHINHRHMRAGKPVTRASLENVHPPIAPPPTEIPERFIMPPDKHHMSHIPPKQHIMM
PPPPLQHVPHEHYNQPHEDIRAPPAELSMAPPPPRSVSQETFRISTRKHSNLITVPIQDD
SNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMPHPPQ
AAGTPHLVYSQAPPPPMTSAPPPITPPPGHIIAQMPPYMNHPPPGPPPPQHGGPPVTAPP
PHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPPPRLQGPPSQTPLPGPHH
PDQTRYRPYYQ
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggatcacactgacaatgagttacaaggcactaatagttctggatccttgggtggtctt
gatgttcgcagacgaattcctataaagctcatctccaaacaagcaaacaaagcgaaacct
gcaccgcgaactcaaagaactataaacaggatgcctgcaaaggctccacctggtgatgaa
gaaggatttgattataatgaagaagaacggtatgactgtaaagggggtgagctgtttgca
aatcagcgaagatttcctggacaccttttttgggactttcagataaacatcttaggtgaa
aaggatgatacaccagttcatttctgtgacaagtgtggattgcctattaaaatctatggg
agaatgattccatgcaagcatgttttttgctatgactgtgctattttacatgaaaaaaag
ggagataagatgtgtccaggctgtagtgatcctgtgcagcgaattgagcagtgtacacga
ggttctctcttcatgtgtagcattgttcaagggtgcaagagaacatatttgtctcagaga
gacttacaggctcatatcaaccatcgccatatgagagctggaaaacctgttacccgtgct
tcacttgaaaatgttcatcctcctattgccccaccaccaactgaaatccctgagcgtttt
ataatgccaccagacaagcaccatatgagccatattccgccaaagcagcacatcatgatg
ccaccacctcctttgcaacatgtgccacatgagcactataatcagccacatgaggatatt
cgtgctcctccagcagaattgtccatggctccacctccacctcgatcggtcagtcaggaa
acctttcgtatttcaacaagaaaacacagcaatttaataaccgtccctattcaggatgac
tcaaattcaggtgctagagaaccaccacctcctgccccagcacctgctcaccatcatcct
gaatatcagggtcaaccagtggtatcgcaccctcatcatattatgcctccacagcaacat
tatgcaccacccccacctcctccaccaccaataagccatccaatgccacatcctccccag
gctgcaggtactcctcacttggtatatagccaagctccacctccaccaatgacctctgct
ccaccaccaataacccctccccctggacatattattgcccagatgccaccttatatgaat
catcctcctccaggacctcccccacctcaacatggtggtccacctgtaactgcaccccct
cctcaccattataatcctaactcattaccccagttcactgaagatcaaggaactctgagc
cctccatttacacaaccagggggaatgagtcctggtatatggcctgcaccaagagggcca
ccaccacctccacgattgcagggtccgccttctcaaaccccacttcctggaccacatcat
ccagatcagacaagatatagaccgtattaccaatga

DBGET integrated database retrieval system