KEGG   Homo sapiens (human): 79873Help
Entry
79873             CDS       T01001                                 

Gene name
NUDT18, MTH3
Definition
(RefSeq) nudix hydrolase 18
  KO
K17817  8-oxo-dGDP phosphatase [EC:3.6.1.58]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    79873 (NUDT18)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.58  8-oxo-dGDP phosphatase
     79873 (NUDT18)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    79873 (NUDT18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX NUDIX_2
Motif
Other DBs
NCBI-GeneID: 79873
NCBI-ProteinID: NP_079091
OMIM: 615791
HGNC: 26194
Ensembl: ENSG00000275074
Vega: OTTHUMG00000163774
Pharos: Q6ZVK8(Tbio)
UniProt: Q6ZVK8
Structure
PDB: 

Position
8p21.3
AA seq 323 aa AA seqDB search
MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVFLSEQDEVLLI
QEAKRECRGSWYLPAGRMEPGETIVEALQREVKEEAGLHCEPETLLSVEERGPSWVRFVF
LARPTGGILKTSKEADAESLQAAWYPRTSLPTPLRAHDILHLVELAAQYRQQARHPLILP
QELPCDLVCQRLVATFTSAQTVWVLVGTVGMPHLPVTACGLDPMEQRGGMKMAVLRLLQE
CLTLHHLVVEIKGLLGLQHLGRDHSDGICLNVLVTVAFRSPGIQDEPPKVRGENFSWWKV
MEEDLQSQLLQRLQGSSVVPVNR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggagggcctggcgggggcgctggcttccgtgctggctggccaggggtccagc
gtgcacagctgcgactcggcgccggccggggagccgccggcgcccgtgcggctgcggaag
aacgtgtgctacgtggtgctggccgtgttcctcagcgagcaggatgaggtgctactgatc
caggaggccaagagggagtgccgggggtcgtggtacctgcctgcggggagaatggagcca
ggggagaccatcgtggaggcgctgcagcgggaggtgaaggaggaggcggggctgcactgt
gagcccgagacactgctgtccgtggaggagcggggcccctcctgggtccgcttcgtgttc
ctcgctcgccccacaggtggaattctcaagacttccaaggaggccgatgcggagtccctg
caggctgcctggtacccacggacctccctgcccactccgctgcgagcccatgacatcctg
cacctggttgaactagccgcccagtatcgccagcaagccaggcaccctctcattctgccc
caagagctaccctgtgatctggtctgccagcggctcgtggctacctttaccagcgcccag
acagtgtgggtgttagtgggcacagtggggatgcctcacttgcctgtcactgcctgtggc
ctcgaccctatggagcagaggggtggcatgaagatggccgtcctgcggctgctgcaggag
tgtctgaccctgcaccacttggtggtggagatcaaggggttgcttggactgcagcacctg
ggccgagatcacagtgatggcatctgtttgaatgtgctggtgaccgtggcttttcggagc
ccagggatccaggatgaacccccaaaagttcggggtgagaacttctcttggtggaaggtg
atggaggaagacctgcaaagccagctcctccagcggcttcagggatcctctgttgtccca
gtgaacagatag

DBGET integrated database retrieval system