KEGG   Homo sapiens (human): 79879
Entry
79879             CDS       T01001                                 
Symbol
CCDC134, OI22
Name
(RefSeq) coiled-coil domain containing 134
  KO
K25417  coiled-coil domain-containing protein 134
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    79879 (CCDC134)
SSDB
Motif
Pfam: ERK-JNK_inhib
Other DBs
NCBI-GeneID: 79879
NCBI-ProteinID: NP_079097
OMIM: 618788
HGNC: 26185
Ensembl: ENSG00000100147
Pharos: Q9H6E4(Tbio)
UniProt: Q9H6E4
Position
22:41800679..41832164
AA seq 229 aa
MDLLQFLAFLFVLLLSGMGATGTLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIH
QQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVL
RFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQN
PFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSEL
NT seq 690 nt   +upstreamnt  +downstreamnt
atggaccttcttcaattcctggccttcctctttgtcctgcttttgtctgggatgggagcc
acaggcaccttgaggacctccctggacccaagcctggagatctacaagaagatgtttgag
gtgaagcggcgggagcagctgttggcactgaagaacctggcacagctgaacgacatccac
cagcagtacaagatccttgatgtcatgctcaaggggctctttaaggtgctggaggactcc
cggacagtgctcaccgctgctgatgtgctcccagatgggcccttcccccaggacgagaag
ctgaaggatgctttctcccacgtggtggagaacacggccttcttcggcgatgtggtgctg
cgcttcccgaggattgtgcactattactttgaccacaactccaactggaacctcctcatc
cgctggggtatcagtttctgcaaccagacaggcgtcttcaaccaggggccccactcgccc
atcctcagcctgatggcccaggagctggggatcagtgagaaagactccaacttccagaac
ccatttaaaatcgaccgcacagagttcattcccagcactgaccctttccagaaggccctg
agagaagaagagaaacgccgaaagaaagaggagaagcggaaggagatccgaaaaggccca
aggatctccagatcccagtctgagttatag

DBGET integrated database retrieval system