KEGG   Homo sapiens (human): 7988Help
Entry
7988              CDS       T01001                                 

Gene name
ZNF212, C2H2-150, ZNF182, ZNFC150
Definition
(RefSeq) zinc finger protein 212
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7988 (ZNF212)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7988 (ZNF212)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 KRAB zf-C2H2_4 DUF3669 zf-H2C2_2 zf-C2H2_6 zf-met zf-C2H2_jaz zf-C2HC_2 zinc_ribbon_15 DUF3268
Motif
Other DBs
NCBI-GeneID: 7988
NCBI-ProteinID: NP_036388
OMIM: 602386
HGNC: 13004
Ensembl: ENSG00000170260
Vega: OTTHUMG00000158968
Pharos: Q9UDV6(Tdark)
UniProt: Q9UDV6 B3KQE6 A0A090N8N3
Position
7q36.1
AA seq 495 aa AA seqDB search
MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKKMESQAA
RLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLRN
RNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSL
KVLGQTEGEAELGTEMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEE
QAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGSRVPSSSRTVGCPKQKSHRQVQLDQ
ECGQGLKLKKDTSRPYECSECEITFRYKQQLATHLRSHSGWGSCTPEEPEESLRPRPRLK
PQTKKAKLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPW
RKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRE
RGGLALEPGRPNGLL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcggcgcctgctcggcacaggagaaaacgacgctccacacctttaacttct
tccacacttccttcacaagcaacagagaaaagctcctattttcagaccaccgagatttca
ctctggacggtggtggccgctattcaggctgtggagaagaagatggagtcccaggctgcc
cggctacagagcctggaggggcgcacggggacagccgagaagaagctggctgactgcgag
aagatggccgtggagttcgggaaccagctggagggcaagtgggccgtgctggggaccctg
ctgcaggagtatgggctactgcagaggcggctggagaacgtggagaacctgctgcgcaac
aggaacttctggatcctgcggctgcccccgggcagcaagggggaggcccccaaggtgtcc
aggtcactggagaatgatggcgtctgtttcaccgagcaggaatgggagaatctggaggat
tggcagaaggagctctacagaaacgtgatggagagtaactatgagacactggtctctctg
aaggtccttggccagacagagggagaagcggagttgggtacagagatgctgggtgacttg
gaagaggaaggtcctggtggtgcccacccagcaggtggggtcatgatcaaacaggagcta
cagtatacacaggaaggccctgcggatcttcctggagagttctcatgcattgctgaagag
caggctttcctgagcccagagcagaccgaactctggggtggtcagggcagttctgtcctc
ttggaaacaggtcctggggactctactctagaggagcctgttggtagtagagttcctagc
agcagcagaactgtgggctgcccgaagcagaaatctcataggcaggtacagctggaccag
gaatgtgggcagggcctgaagctgaaaaaggacacttcccgcccctacgaatgttctgag
tgtgagatcaccttccgctataagcagcagctggccacacatctgcgcagccactctggg
tgggggtcttgtacacctgaggagccagaggagagccttaggcccaggccacggctgaaa
ccacagaccaaaaaggccaagctgcatcagtgtgatgtgtgcctgaggagcttcagctgc
aaggtgagcctggtgacccatcagcgttgccacctgcaggaggggcccagtgccggccag
catgtccaagagaggttctcacccaacagcctggttgccctgcctggccacatcccttgg
aggaaaagccggagttccctcatctgtggttactgtggcaagagcttcagtcacccatct
gacttggtgcggcaccagcgcatccacacgggtgagcggccctacagctgcactgagtgt
gagaagagctttgtccagaagcagcacctcctgcagcaccagaagatccaccagcgggag
cggggtgggctggccctggagcccggaaggcccaatggcctgctttaa

DBGET integrated database retrieval system