KEGG   Homo sapiens (human): 79883
Entry
79883             CDS       T01001                                 
Symbol
PODNL1, SLRR5B
Name
(RefSeq) podocan like 1
  KO
K25038  podocan-like protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    79883 (PODNL1)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class V
    79883 (PODNL1)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_6 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 79883
NCBI-ProteinID: NP_001139726
HGNC: 26275
Ensembl: ENSG00000132000
Vega: OTTHUMG00000181853
Pharos: Q6PEZ8(Tdark)
UniProt: Q6PEZ8 B7Z3M0
Position
19:complement(13931187..13953383)
AA seq 510 aa
MGRPTQWPSLLLLLLLPGPPPVAGLEDAAFPHLGESLQPLPRACPLRCSCPRVDTVDCDG
LDLRVFPDNITRAAQHLSLQNNQLQELPYNELSRLSGLRTLNLHNNLISSEGLPDEAFES
LTQLQHLCVAHNKLSVAPQFLPRSLRVADLAANQVMEIFPLTFGEKPALRSVYLHNNQLS
NAGLPPDAFRGSEAIATLSLSNNQLSYLPPSLPPSLERLHLQNNLISKVPRGALSRQTQL
RELYLQHNQLTDSGLDATTFSKLHSLEYLDLSHNQLTTVPAGLPRTLAILHLGRNRIRQV
EAARLHGARGLRYLLLQHNQLGSSGLPAGALRPLRGLHTLHLYGNGLDRVPPALPRRLRA
LVLPHNHVAALGARDLVATPGLTELNLAYNRLASARVHHRAFRRLRALRSLDLAGNQLTR
LPMGLPTGLRTLQLQRNQLRMLEPEPLAGLDQLRELSLAHNRLRVGDIGPGTWHELQALQ
VRHRLVSHTVPRAPPSPCLPCHVPNILVSW
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggggaggcccacccagtggccgagcctgctgctgctcctgctgttgccggggcccccg
cccgtcgccggcttggaagacgctgccttcccccacctgggggagagcttgcagcccctg
ccccgggcctgtcccctgcgctgctcctgcccccgagtcgacactgtggactgtgatggc
ttggaccttcgagtgttcccggacaacatcaccagagccgctcagcacctctccctgcag
aacaaccagctccaggaactcccctacaatgagctgtcccgcctcagtggcctgcgaacc
ctcaacctccacaacaacctcatctcctccgaaggcctgcctgacgaggccttcgagtcc
ctcacccagctgcagcacctctgcgtggctcacaacaagctctcagtggcccctcagttt
ctgccccggtccctccgtgtcgcggatctggctgccaaccaagtgatggagatcttcccc
ctcacctttggggagaagccggcactcaggtccgtgtacctccacaacaaccagctgagc
aacgctggcctgccccccgacgccttccgcggctccgaggccatcgccaccctcagcctc
tccaacaaccagctcagctacctgccgcccagcctgccgccctcactcgagcggctccac
ctgcagaacaatctcatctccaaggtgccccgaggagccctgagccgccagactcaactc
cgtgagctctacctccagcacaaccagctgacagacagtggcctggatgccaccaccttc
agcaagctgcatagccttgaatacctggatctctcccacaaccagctgaccacagtgccc
gccggcctgccccggaccctggctatcctgcacctgggccgcaaccgcatccggcaggtg
gaggcggctcggctgcacggggcgcgtggtctgcgctatttgttgctgcagcacaaccag
ctggggagctcagggctgcccgccggggctctgcggccgctgcggggcctgcacacgctg
cacctctatggcaatgggctggaccgcgtgcctccagccctgccccgccgcctgcgtgcc
ctggtgctgccccacaaccacgtggccgcgctgggtgcccgtgacctggtcgccacaccg
ggcctgacggagcttaacctggcctataaccgcctggccagcgcccgtgtgcaccaccgg
gccttccgccggttgcgtgccctgcgcagcctcgacctggcagggaatcagctaacccgg
ctgcccatgggcctgcccactggcctgcgcaccctgcagctgcaacgcaaccagctgcgg
atgctcgagcccgagcctctggccggcctggaccaactgcgggagctcagcctggcgcac
aaccggctccgggtcggcgacatcgggccaggcacctggcatgagctccaagccctccag
gtcaggcacaggctggttagccacactgtccccagggcccctccatccccctgcctgccc
tgccacgtcccaaacattctagttagctggtaa

DBGET integrated database retrieval system