KEGG   Homo sapiens (human): 79887Help
Entry
79887             CDS       T01001                                 

Gene name
PLBD1
Definition
(RefSeq) phospholipase B domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Phospholip_B Scm3
Motif
Other DBs
NCBI-GeneID: 79887
NCBI-ProteinID: NP_079105
HGNC: 26215
Ensembl: ENSG00000121316
Vega: OTTHUMG00000168821
Pharos: Q6P4A8(Tdark)
UniProt: Q6P4A8
Position
12p13.1
AA seq 553 aa AA seqDB search
MTRGGPGGRPGLPQPPPLLLLLLLLPLLLVTAEPPKPAGVYYATAYWMPAEKTVQVKNVM
DKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTN
LYPQLITKPSIMDKVQDFMEKQDKWTRKNIKEYKTDSFWRHTGYVMAQIDGLYVGAKKRA
ILEGTKPMTLFQIQFLNSVGDLLDLIPSLSPTKNGSLKVFKRWDMGHCSALIKVLPGFEN
ILFAHSSWYTYAAMLRIYKHWDFNVIDKDTSSSRLSFSSYPGFLESLDDFYILSSGLILL
QTTNSVFNKTLLKQVIPETLLSWQRVRVANMMADSGKRWADIFSKYNSGTYNNQYMVLDL
KKVKLNHSLDKGTLYIVEQIPTYVEYSEQTDVLRKGYWPSYNVPFHEKIYNWSGYPLLVQ
KLGLDYSYDLAPRAKIFRRDQGKVTDTASMKYIMRYNNYKKDPYSRGDPCNTICCREDLN
SPNPSPGGCYDTKVADIYLASQYTSYAISGPTVQGGLPVFRWDRFNKTLHQGMPEVYNFD
FITMKPILKLDIK
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcggcggtccgggcgggcgcccggggctgccacagccgccaccgcttctgctg
ctgctgctgctgctgccgctgttgttagtcaccgcggagccgccgaaacctgcaggagtc
tactatgcaactgcatactggatgcctgctgaaaagacagtacaagtcaaaaatgtaatg
gacaagaatggggacgcctatggcttttacaataactctgtgaaaaccacaggctggggc
atcctggagatcagagctggctatggctctcaaaccctgagcaatgagatcatcatgttt
gtggctggctttttggagggttacctcactgccccacacatgaatgaccactacacaaac
ctctacccacagctgatcacgaaaccttccatcatggataaagtgcaggattttatggag
aagcaagataagtggacccggaaaaatatcaaagaatacaagactgattcattttggaga
catacaggctatgtgatggcacaaatagatggcctctatgtaggagcaaagaagagggct
atattagaagggacaaagccaatgaccctgttccagattcagttcctgaatagtgttgga
gatctattggatctgattccctcactctctcccacaaaaaacggcagcctaaaggttttt
aagagatgggacatgggacattgctccgctcttatcaaggttcttcctggatttgagaac
atcctttttgctcactcaagctggtacacgtatgcagccatgctcaggatatataaacac
tgggacttcaacgtcatagataaagataccagcagtagtcgcctctctttcagcagttac
ccagggtttttggagtctctggatgatttttacattcttagcagtggattgatattgctg
cagaccacaaacagtgtgtttaataaaaccctgctaaagcaggtaatacccgagactctc
ctgtcctggcaaagagtccgtgtggccaatatgatggcagatagtggcaagaggtgggca
gacatcttttcaaaatacaactctggcacctataacaatcaatacatggttctggacctg
aagaaagtaaagctgaaccacagtcttgacaaaggcactctgtacattgtggagcaaatt
cctacatatgtagaatattctgaacaaactgatgttctacggaaaggatattggccctcc
tacaatgttcctttccatgaaaaaatctacaactggagtggctatccactgttagttcag
aagctgggcttggactactcttatgatttagctccacgagccaaaattttccggcgtgac
caagggaaagtgactgatacggcatccatgaaatatatcatgcgatacaacaattataag
aaggatccttacagtagaggtgacccctgtaataccatctgctgccgtgaggacctgaac
tcacctaacccaagtcctggaggttgttatgacacaaaggtggcagatatctacctagca
tctcagtacacatcctatgccataagtggtcccacagtacaaggtggcctccctgttttt
cgctgggaccgtttcaacaaaactctacatcagggcatgccagaggtctacaactttgat
tttattaccatgaaaccaattttgaaacttgatataaaatga

DBGET integrated database retrieval system