KEGG   Homo sapiens (human): 79892
Entry
79892             CDS       T01001                                 

Gene name
MCMBP, C10orf119, MCM-BP
Definition
(RefSeq) minichromosome maintenance complex binding protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: MCM_bind
Other DBs
NCBI-GeneID: 79892
NCBI-ProteinID: NP_079110
OMIM: 610909
HGNC: 25782
Ensembl: ENSG00000197771
Vega: OTTHUMG00000019159
Pharos: Q9BTE3(Tbio)
UniProt: Q9BTE3
Position
10q26.11
AA seq 642 aa
MPCGEDWLSHPLGIVQGFFAQNGVNPDWEKKVIEYFKEKLKENNAPKWVPSLNEVPLHYL
KPNSFVKFRCMIQDMFDPEFYMGVYETVNQNTKAHVLHFGKYRDVAECGPQQELDLNSPR
NTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNK
QKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQQLNSLNLSSPFDLNFPLPGEKGPACL
VKVYEDWDCFKVNDILELYGILSVDPVLSILNNDERDASALLDPMECTDTAEEQRVHSPP
ASLVPRIHVILAQKLQHINPLLPACLNKEESKTCKFVSSFMSELSPVRAELLGFLTHALL
GDSLAAEYLILHLISTVYTRRDVLPLGKFTVNLSGCPRNSTFTEHLYRIIQHLVPASFRL
QMTIENMNHLKFIPHKDYTANRLVSGLLQLPSNTSLVIDETLLEQGQLDTPGVHNVTALS
NLITWQKVDYDFSYHQMEFPCNINVFITSEGRSLLPADCQIHLQPQLIPPNMEEYMNSLL
SAVLPSVLNKFRIYLTLLRFLEYSISDEITKAVEDDFVEMRKNDPQSITADDLHQLLVVA
RCLSLSAGQTTLSRERWLRAKQLESLRRTRLQQQKCVNGNEL
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgccgtgtggggaggattggctcagccacccgctgggaatcgtgcagggattcttcgcc
caaaatggagttaatcctgactgggagaagaaagtaattgagtattttaaggaaaagctg
aaggaaaataatgctcctaagtgggtaccatcactgaacgaagttccccttcattatttg
aaacctaatagttttgtgaaatttcgttgcatgattcaggatatgtttgaccctgagttt
tacatgggagtttatgaaacggttaaccaaaacacaaaagcacatgttcttcattttgga
aaatatagagatgtagcagagtgtgggcctcaacaagaacttgatttaaactctccacga
aataccactttggaaagacagactttctattgtgttccggtgcctggggaatctacgtgg
gtaaaagaagcctatgttaatgcaaaccaagctcgagtcagtccctcaacatcctacact
cctagtcgccacaagaggagttatgaagatgatgacgatatggacctacagcccaataag
cagaaagaccaacatgcaggtgccagacaagcagggagtgttggtggtcttcaatggtgt
ggagagccaaaacgtttagaaactgaagcttctactgggcaacagctgaactctctgaac
ttgtcttctccttttgatttgaattttccattgccaggagagaagggccctgcatgcctt
gtgaaggtttatgaagattgggattgtttcaaagtaaatgacattcttgagctatatggc
atactgtctgtggatcctgtgctgagtatactgaataatgatgaaagggatgcctctgca
ctgctggatccgatggagtgcacagacacagcagaggagcagagagtacacagtcctcct
gcttcattagtgccgagaattcatgtgatcttagcccagaagttgcaacacatcaaccca
ttattgcctgcctgccttaacaaagaggagagcaaaacctgtaagtttgtttcaagtttc
atgtccgaattgtctccagtcagagcagaacttcttgggttccttactcatgcccttctg
ggggatagtttggctgctgaataccttatattacatctcatctccacagtatatacaaga
agagatgtccttccactaggaaaatttacagttaacttgagtggttgcccacggaatagt
accttcacagaacacttgtatcgaattattcaacatcttgttccagcatcttttcgtctg
cagatgactatagagaacatgaaccatttgaaattcattccccacaaagactacacagcc
aatcgcttggtcagtgggctcctccagctgcccagcaatacttcccttgtaatcgatgag
actctcctggaacaggggcagctggataccccaggtgttcataatgtgacagccctgagc
aacctcataacgtggcagaaggtggattatgacttcagctaccatcagatggaattcccc
tgcaatattaacgttttcattacttcggaggggaggtcactcctcccggcagactgccag
attcacttacagccccagctaattccaccaaacatggaggagtacatgaacagccttctc
tcagcggtgctgccttccgtgctgaacaaattccgcatttatctaactcttttgagattc
ttggaatatagcatatctgatgaaataaccaaggcagttgaagatgactttgtggaaatg
cggaagaacgaccctcagagcatcactgctgatgatcttcaccagctgctcgtggtggct
cggtgtctgtctctcagtgctggtcagacaacgctgtcaagagaacgatggctgagagca
aagcagctagagtctttaagaagaacgaggcttcagcagcaaaaatgtgtgaatggaaat
gaactttaa

DBGET integrated database retrieval system