KEGG   Homo sapiens (human): 79895Help
Entry
79895             CDS       T01001                                 

Gene name
ATP8B4, ATPIM
Definition
(RefSeq) ATPase phospholipid transporting 8B4 (putative)
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    79895 (ATP8B4)
Enzymes [BR:hsa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     79895 (ATP8B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Cation_ATPase Hydrolase E1-E2_ATPase Hydrolase_3 DUF4404
Motif
Other DBs
NCBI-GeneID: 79895
NCBI-ProteinID: NP_079113
OMIM: 609123
HGNC: 13536
Ensembl: ENSG00000104043
Vega: OTTHUMG00000172368
Pharos: Q8TF62(Tdark)
UniProt: Q8TF62 Q6PG43
Position
15q21.2
AA seq 1192 aa AA seqDB search
MFCSEKKLREVERIVKANDREYNEKFQYADNRIHTSKYNILTFLPINLFEQFQRVANAYF
LCLLILQLIPEISSLTWFTTIVPLVLVITMTAVKDATDDYFRHKSDNQVNNRQSEVLINS
KLQNEKWMNVKVGDIIKLENNQFVAADLLLLSSSEPHGLCYVETAELDGETNLKVRHALS
VTSELGADISRLAGFDGIVVCEVPNNKLDKFMGILSWKDSKHSLNNEKIILRGCILRNTS
WCFGMVIFAGPDTKLMQNSGKTKFKRTSIDRLMNTLVLWIFGFLICLGIILAIGNSIWES
QTGDQFRTFLFWNEGEKSSVFSGFLTFWSYIIILNTVVPISLYVSVEVIRLGHSYFINWD
RKMYYSRKAIPAVARTTTLNEELGQIEYIFSDKTGTLTQNIMTFKRCSINGRIYGEVHDD
LDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSE
ENSAGELIYQVQSPDEGALVTAARNFGFIFKSRTPETITIEELGTLVTYQLLAFLDFNNT
RKRMSVIVRNPEGQIKLYSKGADTILFEKLHPSNEVLLSLTSDHLSEFAGEGLRTLAIAY
RDLDDKYFKEWHKMLEDANAATEERDERIAGLYEEIERDLMLLGATAVEDKLQEGVIETV
TSLSLANIKIWVLTGDKQETAINIGYACNMLTDDMNDVFVIAGNNAVEVREELRKAKQNL
FGQNRNFSNGHVVCEKKQQLELDSIVEETITGDYALIINGHSLAHALESDVKNDLLELAC
MCKTVICCRVTPLQKAQVVELVKKYRNAVTLAIGDGANDVSMIKSAHIGVGISGQEGLQA
VLASDYSFAQFRYLQRLLLVHGRWSYFRMCKFLCYFFYKNFAFTLVHFWFGFFCGFSAQT
VYDQWFITLFNIVYTSLPVLAMGIFDQDVSDQNSVDCPQLYKPGQLNLLFNKRKFFICVL
HGIYTSLVLFFIPYGAFYNVAGEDGQHIADYQSFAVTMATSLVIVVSVQIALDTSYWTFI
NHVFIWGSIAIYFSILFTMHSNGIFGIFPNQFPFVGNARHSLTQKCIWLVILLTTVASVM
PVVAFRFLKVDLYPTLSDQIRRWQKAQKKARPPSSRRPRTRRSSSRRSGYAFAHQEGYGE
LITSGKNMRAKNPPPTSGLEKTHYNSTSWIENLCKKTTDTVSSFSQDKTVKL
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcagtgaaaagaaattgcgtgaagtggaacggatagtgaaagccaatgaccgt
gaatataatgaaaagttccagtatgcggataatcgtatccacacatcgaaatataatatt
ctcaccttcttgccaattaatttatttgaacagttccaaagagtggcaaatgcctatttt
ctttgccttctgattttacagctaattccagaaatttcctccttgacctggtttaccacc
attgtgcctttggtcctggtgataactatgacagctgtcaaagatgccacagatgactat
tttcgccacaagagtgataatcaagtgaataatcggcagtctgaagtgctcatcaacagc
aaactgcagaatgaaaaatggatgaatgtcaaagtgggagacatcattaaattagaaaat
aaccaatttgttgctgctgatttacttctcctatcaagtagtgagccacatggtctctgt
tatgttgaaactgctgagcttgatggggaaacgaacctaaaagtccgccatgcactatca
gttacttcagaacttggagcagatatcagcagacttgcagggtttgatgggattgttgtc
tgtgaggtgcctaacaacaagttagataaattcatgggaatcctttcttggaaagacagc
aagcattccctcaacaatgagaagataatcctgagaggctgcatcctgagaaataccagc
tggtgttttggaatggttatttttgcaggtcctgacactaaactaatgcagaatagtggt
aagacaaagtttaaaaggacaagcattgatagattgatgaatactctagtactatggatt
tttgggtttctgatatgcttgggaattattcttgcaataggaaattcaatctgggagagt
caaactggggaccaattcagaactttcctcttttggaatgaaggagagaagagctctgtg
ttctccggattcttaacattctggtcatatattattattctcaatacagttgtacccatt
tccttatatgtgagtgtggaagtaattcgtctaggacacagttattttataaactgggac
cggaagatgtattattctcgaaaagcaatacctgcagtggctcgaacgaccacgctcaat
gaggaactggggcagattgagtacattttctccgacaaaacgggtaccctcactcaaaac
atcatgacctttaaaagatgttccattaatgggagaatctatggtgaagtacatgatgac
ctggatcagaagacagaaataactcaggaaaaagagcctgtggatttctcagtcaaatct
caagcggatagagaatttcagttctttgaccaccatctgatggaatccattaaaatgggt
gatcccaaagttcatgaattccttaggttacttgctctctgccacactgtaatgtcagaa
gagaatagcgcaggagagctgatttaccaagttcagtcacctgatgaaggggctctagtg
actgccgctagaaattttgggttcatttttaaatcccggaccccagagaccataacaata
gaagaattgggaacactagttacttatcaattacttgcctttttggatttcaacaacacc
agaaaaaggatgtctgtcatagttcgaaacccagaaggacagataaagctttattccaaa
ggagcagatactattctgtttgaaaaacttcatccttccaatgaagtccttttgtctttg
acgtcagaccacctcagtgaatttgcaggggaaggccttcggaccttggccatcgcatac
agagacctggatgacaagtactttaaagagtggcataagatgcttgaagatgcgaatgct
gccacagaagagagggatgaacgaatagctgggctatatgaagaaattgaaagagatttg
atgctactaggtgccactgctgtagaagataagttacaggagggtgttattgaaacagtt
acaagtttatcactagccaatattaagatctgggtcctaacaggagacaaacaagaaact
gccatcaacatcggttatgcctgcaacatgctgactgacgacatgaatgatgtgtttgtg
atagcagggaataatgctgtggaagtgagagaagaactcaggaaagcaaaacaaaatttg
tttggacaaaacagaaatttttccaatggccatgtagtttgtgaaaaaaagcagcagctg
gagttggattctattgtagaagaaaccataacaggagattatgccttaatcataaatggc
cacagtttggctcatgccctagaaagtgatgtcaagaatgatctcctagaacttgcttgc
atgtgtaagactgtaatttgctgcagggtcactccactccagaaagcccaagtggtagag
ctggtgaagaagtacagaaatgctgttactttggccattggtgatggagccaatgatgtc
agcatgattaaaagtgctcacattggtgttggcatcagcggccaggaaggattgcaagca
gtcttagccagcgactattcatttgcacagtttagatatctccaaaggcttctccttgtt
catggaaggtggtcttatttccgaatgtgcaaattcttatgctatttcttctataagaat
tttgcatttacacttgtgcatttctggtttggtttcttctgtggtttctcagcccagact
gtttatgaccagtggttcatcaccctttttaacattgtttacacatcactgcctgtttta
gccatggggatttttgaccaggatgtgagtgaccagaacagcgtggactgtccccagctc
tacaaaccaggacagctgaatctgctttttaacaagcgtaaatttttcatttgcgtgttg
catggaatctacacctcattagtccttttcttcatcccctatggggccttttacaacgtg
gctggagaagatgggcaacatattgctgactaccagtcctttgcagttaccatggccaca
tctttggtcattgtggtcagtgtgcagatagccttggataccagttactggactttcatt
aatcacgtcttcatctgggggagcattgccatttatttctccattttatttacaatgcac
agtaatggcatctttggcatcttcccaaaccagtttccatttgttggtaatgcacgacat
tccctgacccagaagtgcatctggcttgtaattctcttaacaacagtggcttcagttatg
ccagtggtggcattcagatttttgaaggtggatttatacccaaccctgagtgatcagatc
cgccggtggcagaaggctcaaaagaaggcaaggcctccaagtagccgaaggcctcggacc
cgcaggtcaagctcaagaaggtctggatatgcttttgctcaccaagaaggctatggagag
cttatcacatctggaaaaaatatgcgagctaaaaatccacccccaacatcagggctggaa
aagacacattataatagcactagctggattgaaaatttatgtaagaaaaccacagacacc
gtgagcagctttagccaggataaaacagtgaaactgtga

DBGET integrated database retrieval system